KEGG   Leptothrix cholodnii: Lcho_3246Help
Entry
Lcho_3246         CDS       T00681                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lch  Leptothrix cholodnii
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lcho_3246
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lcho_3246
   00600 Sphingolipid metabolism
    Lcho_3246
Enzymes [BR:lch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Lcho_3246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3601416..3603602
Genome map
AA seq 728 aa AA seqDB search
MNTRTHSASLPDSPAQFIALHGRASSIVIEAHADEAPIWRYWGPRLPDAATPGAALRDSR
PLPSFMLDFDQPLTVAPTFGVGWFGQSALLAHRDGLDFAQAYTRCEIEWLAPGSAVCLHL
HDDVARLRLDLTLKLDAASDVLTLQSTLHNLGDSAIDVQWLASGTLPLPGHSQQVRSYAG
QHVHEFLLQTDPLTRSLWRKESRRGRTSHDCFPGAVVTTPGATDDAGLVFGAHLAWSGNH
QQTIEWLHDGQYQWQMGEWLAPGEGRLAPGQALHTPEIVASCSTAGLNGLAANFHAELRS
RLNWPGGAMRARPVHLNTWEGFYFDVHPGPVKELATAAAAVGIERFVLDDGWFHGRHHDR
AALGDWWPDESKFPAGLGELIGHVNGLGMSFGLWVEPEMVNPDSELFRAHPDWALQVAGR
PLLTARNQLVLDISRPEAADYLFDKISALLAAHPIDYLKWDHNRDLAPAGLANGAPGYRA
QVHAVYALMARLRAAHPQVEIESCSGGGGRIDFAVLRHTHRVWTSDCIDALSRVAIQRGF
LQFFPPEIMGSHVGTAPSHTTGRTQNMAFRAAVALPGHLGVELDVRHLNEAETTELRAWI
ALYKQLRDRLHTGRVWLGEVADGIAWQAHGNAAAGDVLLLVYRTAPSSHRYTPVLRLTML
DAGARYRVHEVLPDGTVRATGHHNTAPFFDAINTPEGLTLDGAWLAHAGLPLPRAQAETA
FIVRLQKV
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccgcacccactccgcatccctgcctgacagccccgcgcagttcatcgcgctg
cacggccgcgccagcagcatcgtcatcgaagcccatgccgacgaggcgccgatctggcgc
tactggggcccgcgcctgcccgatgcggcgacacccggcgcggccttgcgcgacagccgg
ccgctgccgtccttcatgctcgatttcgaccagccgctgacggtggcaccgaccttcggc
gtcggctggttcggccagagcgcgctgctggcgcaccgcgacgggctcgacttcgcgcag
gcgtacacgcgctgcgagatcgaatggctggcgcccggctcggccgtctgtctgcacctg
cacgacgacgtcgcccgcctgcgcctggacctcacgctcaagctcgacgcggccagcgac
gtgctcacgctgcagagcacgctgcacaacctgggcgacagcgcgatcgacgtgcaatgg
ctcgcctcgggcacgctgccgctgcccggccacagccagcaggtgcgctcctacgccggc
cagcacgtgcatgaattcctgctgcagaccgatccgctgacgcgcagcctgtggcgcaag
gaaagccggcgcggccgcaccagccacgactgctttcccggtgcggtggtgaccacgccc
ggcgccaccgacgacgccggcctggtgttcggcgcgcacctcgcgtggtcgggcaaccac
cagcagaccatcgagtggctgcacgacggccaataccagtggcagatgggcgagtggctg
gcacccggcgaaggccggctcgcaccgggccaggcgctgcacacgcccgagatcgtggcg
agctgctcgaccgccggcctgaacggcctggccgccaacttccacgccgagctgcgctcg
cgcctgaactggccgggcggcgcgatgcgcgcgcggccggtgcacctcaacacctgggaa
ggcttctacttcgacgtccaccccggcccggtcaaggaactcgccaccgccgccgcggcc
gtgggcatcgagcgcttcgtgctcgacgacggctggttccacggtcgccaccacgaccgc
gccgcgctcggcgactggtggcccgacgagagcaagttccccgccggcctgggcgagctg
atcggccacgtcaacggcctcggcatgagcttcggcctgtgggtcgagcccgagatggtc
aaccccgacagcgagctgttccgcgcccacccggactgggcgctgcaggtcgccggccgg
ccgctgctgaccgcgcgcaaccagttggtgctcgacatctcgcgccccgaggcggccgac
tacctgttcgacaagatctccgcgctgctggccgcgcacccgatcgactacctgaagtgg
gaccacaaccgcgacctcgcaccggccggcctggccaacggcgcgcccggttatcgggcc
caggtgcatgcggtctacgcgctgatggcgcggctgcgcgcggcccatccgcaggtcgag
atcgagagctgctcgggcggcggcgggcgcatcgatttcgcggtgctgcgccacacccat
cgggtctggaccagcgactgcatcgatgccctctcgcgggtggcgatccagcgcggcttt
ctgcagttcttcccgcccgagatcatgggctcgcacgtcggcaccgcgccctcgcacacc
accgggcgcacgcagaacatggccttccgcgccgcggtggcgctgcccggccacttgggc
gtcgagctcgacgtgcggcacctgaacgaggccgagaccaccgagctgcgcgcctggatc
gcgctctacaagcagctgcgcgatcgcctgcacacgggccgggtctggctgggcgaggtg
gccgacggcatcgcctggcaggcccatggcaacgcggccgcgggcgacgtgctgctgctg
gtctaccgcacggcgccgagctcgcaccgctacacgccggtgctgcgcctgaccatgctc
gacgccggcgcgcgctaccgcgtgcacgaggtgctgcccgacggcaccgttcgcgccacc
ggccaccacaacaccgcgccgttcttcgatgccatcaacacgcccgaaggcctgacgctc
gacggcgcctggctcgcccacgccggcctgccgctgccgcgtgcgcaggccgagaccgcg
ttcatcgtgcggctgcagaaggtctga

DBGET integrated database retrieval system