KEGG   Leptothrix cholodnii: Lcho_3330Help
Entry
Lcho_3330         CDS       T00681                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lch  Leptothrix cholodnii
Pathway
lch00010  Glycolysis / Gluconeogenesis
lch00052  Galactose metabolism
lch00500  Starch and sucrose metabolism
lch00520  Amino sugar and nucleotide sugar metabolism
lch00521  Streptomycin biosynthesis
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
Module
lch_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_3330
   00052 Galactose metabolism
    Lcho_3330
   00500 Starch and sucrose metabolism
    Lcho_3330
   00520 Amino sugar and nucleotide sugar metabolism
    Lcho_3330
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lcho_3330
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Lcho_3330
Enzymes [BR:lch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lcho_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 HTH_IclR MarR_2 HTH_23 HTH_36 HTH_Tnp_ISL3 HTH_38
Motif
Other DBs
NCBI-ProteinID: ACB35588
JGI: Lcho3330
UniProt: B1Y2D5
Position
3707146..3708996
Genome map
AA seq 616 aa AA seqDB search
MIAPELTSAYPDGLRLLADVGASNVRFALESAPDRYWASEVLPCSAHESLEAAVRTFLLA
HGSPPVRHAAFSLPNPIAGDQVQLTNHPWAFSVEAMRRALGLQTLLVVNDYTALAMGLTR
LDAGERIKVGGGEPVTGGVQGVIGPGSGLGVSALVLVQDRYVALSSEGGHVSYPPQDDDE
EQVVAAARQRYGHASGERLISGPGLELIHEVIAAQTGHQPARLAAPEISARALATPPCPV
AQRALAVFCAMLGTVAGNLALTLGSVGGLYIGGGIVPQILPFFEASAFRRRFEQKGRFSQ
WLTQIPTWVVVAPRSALRGTSAFLEDHLTADHGAEPLLDDVRAALPRLSTSERLVAGDLL
SAPRAWMSDSIARIADRCGVSTPTVMRFCRTMGFKGLADFKLRLGAGLSGSTKVAHRPVR
AADPTAERMATILNNSISALIELRDRLHPQAFEQAVKLLANARRIEVYGVGAAALAAEEA
QHKFGRLGLQVVARTDSQLQNVTAAFLGPDDVLLVLSNSGAVDPVNEAVMRARRSGTRVI
GMCPQRSDLARLSDVILPVDHPEDLQALVPMVSRLMQTVIVDVLVTDLALQRRDHINAAL
VRQDDQRYAFLSSHGS
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccctgaactgacatccgcctaccccgacggcctgcgcctgctggccgatgtc
ggcgcctcgaacgtgcgctttgcgctcgaatcggcacccgatcgctactgggcgagcgag
gttctgccctgttctgcgcatgaatcgctcgaggccgcggtgcgcaccttcctgctcgcg
cacggctcgccgccggttcgtcacgcggcgttttcgctgcccaacccgatcgccggcgac
caggtgcagctgaccaaccatccgtgggcgttttcggtcgaggccatgcggcgcgcgctg
ggcctgcagacgctgctggtggtcaacgactacaccgcgctggcgatggggctgacccgg
ctcgacgccggcgagcgcatcaaggtgggcggcggcgagccggtcaccggcggcgtgcag
ggcgtgatcgggccgggcagcgggctgggggtgtcggccctggtgctggtgcaggaccgt
tacgtggcgctgtcgagcgagggcggccacgtcagctacccgccgcaggacgacgacgag
gaacaggtcgtcgctgcggcccgccagcgttacggccatgcgtcaggcgagcggctgatc
tcggggccggggctggagctgatccacgaggtgatcgccgcgcagaccggccaccagccc
gcccgcctcgcggcgcccgagatctcggcgcgcgccctggccacgccgccgtgcccggtg
gcgcagcgcgcgctggcggtgttctgcgccatgctcggcacggtggcgggcaacctggcg
ctgacgctgggcagcgtcggcggcctctacatcggcgggggcatcgtgccgcagatcctg
ccgttcttcgaggcctcggcgttccgccggcgcttcgagcagaagggccgtttcagccag
tggctgacgcagatcccgacctgggtggtggtggcaccgcgttcggcgctgcgcggcacg
tcggcctttctggaggatcacctcaccgccgaccacggcgccgagccgctgctcgacgac
gtgcgcgcggcgctgccgcggctgtcgacctccgagcgcctggtggcgggcgacctgctg
tcggcgccacgcgcctggatgagcgactcgatcgcccgcatcgccgatcgctgcggcgtc
agcacgcccacggtgatgcgcttctgccgcacgatggggttcaaggggctggcggatttc
aagctgcggctcggtgccgggctgtcgggcagcaccaaggtcgcgcaccgcccggtgcgc
gccgccgatccgaccgccgagcgcatggccaccatcctcaacaactcgatctcggcgctg
atcgagctgcgcgaccggctgcatccgcaggccttcgagcaggccgtcaagctgctggcc
aacgcgcgccggatcgaggtctacggcgtcggcgccgccgcgctggcggccgaggaggcg
cagcacaagttcggccggctgggcctgcaggtggtggcgcgcaccgactcgcagctgcag
aacgtgacggcggcgttcctcggccccgacgacgtgctgctggtgctgtcgaactcgggc
gcggtcgatccggtcaacgaggccgtgatgcgggcgcgccgcagcggcacgcgggtgatc
gggatgtgcccgcagcgcagcgacctggcccggctgtccgacgtgatcctgccggtcgat
cacccggaggacctgcaggcgctggtgccgatggtgtcgcggctgatgcagacggtgatc
gtcgacgtgctggtcaccgatctggcgctgcagcggcgcgaccacatcaacgccgcgctg
gtgcgccaggatgatcagcgctacgccttcctgagctcgcacggcagctga

DBGET integrated database retrieval system