KEGG   Leptothrix cholodnii: Lcho_3331Help
Entry
Lcho_3331         CDS       T00681                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lch  Leptothrix cholodnii
Pathway
lch00010  Glycolysis / Gluconeogenesis
lch00052  Galactose metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
Module
lch_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_3331
   00052 Galactose metabolism
    Lcho_3331
Enzymes [BR:lch01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Lcho_3331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACB35589
JGI: Lcho3331
UniProt: B1Y2D6
Position
3709076..3710215
Genome map
AA seq 379 aa AA seqDB search
MTHARIATPIDSDADPDEPEAAIQVLHWPGGLRVKLSPWGAAWLSCCVPMPDGDWREALL
QPRHARIGPAQPRSFMGSTLGRYANRIAHGRLARGDQVVSLARGDGERHHLHGGPDGWDT
RRWAQPAVAATDDALEAVYTLTSVAGDQGYPGTAQAQVRYRLIDAQTLEIDYEVRVDAPS
PIGLSNHAYFNLDARQAGDAGDVRDHHLQIHADRVLPVDPDCIPLEGPVPVADLPGFDFR
RATRLRTQLDGHLDASEQLRAQRGHDHAYVLESTEDAAAGDSPDRLREAAVLSAADGRLQ
MTLSTTLPALQLYTGQLLAGSPAPGGRTHHAHAGLALEPQYLPDSPNRRWAAAGTPGDCW
LLPGQVWRQRIRYRFTTAG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgcccgaatcgccacgccgatcgactccgatgccgacccggacgaaccggag
gccgcaatccaggtgctgcactggcccggcggcttgcgcgtgaagctgtcgccatggggc
gcggcgtggctgagctgctgcgtgccgatgcccgacggcgactggcgcgaagccctgctg
cagccacgccacgcccgcatcgggccggcgcagccacgcagtttcatgggcagcacgctc
ggccgctacgccaaccgcatcgcgcacgggcgcctcgcgcggggcgatcaggtggtgtcg
ctcgcacggggcgacggcgaacggcatcacctgcacggcgggccggacggctgggacacg
cggcgctgggcgcagccggcggtggccgcgacggacgatgcgctggaggccgtctacacg
ctaacgtcggtggccggcgaccagggctaccccggcacggctcaggcgcaggtgcgctac
cggctgatcgatgcgcagacgctggagatcgactacgaggtgcgggtcgacgcaccgtca
ccgatcgggctcagcaaccacgcctacttcaacctcgatgcgcgccaggcgggggacgcc
ggcgacgtgcgcgaccaccacctgcagatccacgccgatcgggtgctgccggtcgatccg
gactgcatcccgctggaagggccggtgccggtggccgatctgccgggtttcgatttccgc
cgcgcgacacggctgcgaacgcagctggacggacatctggatgcgagcgaacagctgcga
gcgcaacgcggccatgaccatgcctacgtgctggaatcgaccgaggatgccgctgcagga
gacagcccggacaggctgcgcgaggcggcggtgctgagcgcagccgacggccggctgcag
atgacgctgagcaccacgctgccggccctgcagctctacaccggccagctcctggccggc
tcgccggcgccgggcggtcgcacgcaccacgcccatgccgggctggcgctggagccgcag
tacctgcccgacagcccgaaccggcgctgggccgcagccggcacgccgggcgactgctgg
ctgctgccgggtcaggtgtggcggcagcgcatccgctaccgcttcaccaccgcgggctga

DBGET integrated database retrieval system