KEGG   Leptothrix cholodnii: Lcho_3876Help
Entry
Lcho_3876         CDS       T00681                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lch  Leptothrix cholodnii
Pathway
lch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01130  Biosynthesis of antibiotics
lch01230  Biosynthesis of amino acids
Module
lch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lcho_3876
Enzymes [BR:lch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Lcho_3876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C GlnE
Motif
Other DBs
NCBI-ProteinID: ACB36130
JGI: Lcho3876
UniProt: B1Y7I2
Position
complement(4349225..4350013)
Genome map
AA seq 262 aa AA seqDB search
MSDILNKIVATKHEEIAAARAHRGLVSLRDEAEARTDVRGFEAAMRAKIAAGQAAVIAEV
KKASPSKGVLREDFRPAEIAASYERHGAACLSVLTDALYFQGCADYLRQARAACALPVLR
KDFMVDEYQVHEARAMGADAILLIAACLDDAQMADLEAVALAHRMSVLVEVHDRDELQRA
LRLKTPLLGINNRNLRTFEVTLDTTLGMLGEVPSDRLLVTESGILGRDDVQRMRAAQVHA
FLVGEAFMRASDPGVALAALFA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatcctgaacaagatcgtcgcgaccaaacacgaggaaatcgccgcggcgcgt
gcgcatcgtggcctggtctcgttgcgcgacgaagccgaagcccgcaccgacgtgcgcggc
ttcgaggcggccatgcgcgccaagattgcggcgggccaggcggcggtgatcgccgaggtc
aagaaggccagcccgagcaagggcgtgctgcgcgaggatttccgcccggccgagatcgcc
gcgagctacgagcgccacggcgccgcctgcctgagcgtgctgaccgacgcgctctatttc
cagggctgcgccgactacctgcgtcaggcccgcgcggcctgcgcgctaccggtgctgcgc
aaggatttcatggtcgacgagtaccaggtgcacgaggcccgcgcgatgggcgccgacgcc
atcctgctgatcgcggcctgcctcgacgacgcgcagatggccgatctggaggcggtggcg
ctggcgcaccgcatgagcgtgctggtcgaggtgcacgatcgtgacgaactgcaacgtgcg
ctgcgcctgaagacgccactgctgggtatcaacaaccgcaatctgcgcaccttcgaggtc
acgctcgacacgacgctgggcatgctcggagaggtgccgtcggatcgcctgctggtcacc
gaatcgggcatcctggggcgtgacgacgtgcagcgcatgcgcgcggcccaggtgcatgcc
ttcctggtcggcgaggccttcatgcgcgcgtcggatccgggcgtggcgctggccgcgctg
tttgcctga

DBGET integrated database retrieval system