KEGG   Leptothrix cholodnii: Lcho_3953Help
Entry
Lcho_3953         CDS       T00681                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lch  Leptothrix cholodnii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lch03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4433060..4433635
Genome map
AA seq 191 aa AA seqDB search
MIGRLTGTLAEKSPPQLLVDVGGVGYEVDVPMSTFYNLPVLGERVTLLTHFVVREDAQLL
YGFLTATERATFRQLLKISGVGARTALSILSGLSVADLAQAVSAQEAGRLVKVPGIGKKT
AERLLLELKGKLGPDLALPGAVIRNEAQSDIVQALIALGYNEREAAAAIKPLPADVGVSD
GIKLALRALGK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgtctcaccggcaccctggccgaaaaatccccgccccagctgctcgtcgac
gtgggcggcgtcggctatgaagtcgacgtgccgatgagcaccttctacaacctgccggtg
ctgggcgaacgcgtcacgctgctgactcacttcgtggtgcgcgaggacgcccagctgctc
tacggcttcctgaccgccaccgaacgcgccaccttccgccagctgctcaagatcagcggc
gtgggcgcacgcaccgccttgtcgatcctgtcgggcctgagcgtggccgacctggcgcag
gcggtcagcgcccaggaggccggccggctggtcaaggtgcccggcatcggcaagaagacc
gccgagcgcctgctgctcgaactcaagggcaagctcggccccgacctggcgctgcccggc
gcggtgatccgcaacgaggcgcaatccgacatcgtgcaggcgctgatcgcgctgggatac
aacgagcgcgaagccgccgccgccatcaagccgctgccggcggacgtgggcgtgagcgac
ggcatcaagctcgccttgcgcgccctcggcaagtga

DBGET integrated database retrieval system