KEGG   Leptothrix cholodnii: Lcho_3959Help
Entry
Lcho_3959         CDS       T00681                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lch  Leptothrix cholodnii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lch00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lch00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4438158..4439120)
Genome map
AA seq 320 aa AA seqDB search
MLSRRNPQLNNHGELIHLLSTEGLPRAVLTQILDTASTFLSVNDRDVKKVPLLRGKSVFN
LFFENSTRTRTTFEIAAKRLSADVINLDIAKSSAAKGESLLDTIANLSAMHADMFVVRHS
ESGAPYLIAEHCAPHVHVVNAGDGRHAHPTQGLLDMYTIRHYKKDFTGLRVAIVGDIVHS
RVARSDIHALTTLGVPDIRAVGPKTLVPGDLRDMGVRVCHDMAEGIKDADVIIMLRLQNE
RMSGAMLPSAGEYFKSYGLTADKLALAAPDCIVMHPGPINRGVEIESTVADGAHSVILPQ
VTFGIAVRMAVMSIIAGNDA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgcgtcgcaacccccagctcaacaaccacggcgagctgatccacctgctgtcg
accgaaggcctgccacgcgccgtgctgacgcagatcctcgacaccgccagcacctttctg
tcggtcaacgaccgtgacgtcaagaaggtgccgctgctgcggggcaagagcgtgttcaac
ctgttcttcgagaacagcacgcgcacccgcaccaccttcgagatcgccgccaagcggctg
tcggccgacgtcatcaacctcgacatcgccaagagcagcgcggccaagggcgagagcctg
ctcgacaccatcgccaacttgagcgcgatgcacgccgacatgttcgtggtgcgccacagc
gagagcggtgcgccgtatctcatcgccgagcactgcgcgccgcacgtgcacgtggtcaac
gccggcgacggccgccacgcgcacccgacgcaggggctgctcgacatgtacacgatccgc
cactacaagaaggacttcaccgggctgcgggtggcgatcgtgggcgacatcgtgcacagc
cgcgtggcgcgctcggacatccacgcgctgaccacgctgggcgtgcccgacatccgcgcc
gtcggccccaagaccctggtgccgggcgacctgcgcgacatgggcgtgcgggtgtgccac
gacatggccgagggcatcaaggatgccgacgtcatcatcatgctgcgcctgcagaacgag
cgcatgagcggcgcgatgctgcccagcgcgggcgagtacttcaagagctacggcctgacc
gccgacaagctggcgctggccgcgccggactgcatcgtgatgcacccggggccgatcaac
cgcggcgtcgagatcgagtcgaccgtggccgatggcgcgcacagcgtgatcctgccgcag
gtcaccttcggcatcgccgtgcgcatggcggtcatgtccatcatcgcgggtaacgacgca
tga

DBGET integrated database retrieval system