KEGG   Leptothrix cholodnii: Lcho_3976Help
Entry
Lcho_3976         CDS       T00681                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lch  Leptothrix cholodnii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lcho_3976
   01230 Biosynthesis of amino acids
    Lcho_3976
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_3976
   00030 Pentose phosphate pathway
    Lcho_3976
   00051 Fructose and mannose metabolism
    Lcho_3976
   00052 Galactose metabolism
    Lcho_3976
  Energy metabolism
   00680 Methane metabolism
    Lcho_3976
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Lcho_3976
Enzymes [BR:lch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lcho_3976
Protein phosphatases and associated proteins [BR:lch01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Lcho_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4462390..4463478)
Genome map
AA seq 362 aa AA seqDB search
MSQTTDSQNPAPRIGVLTGGGDCPGLNAVIRAVTKSLIYQCGAEVIGVEDGFLGLIEHRV
RPLDWRSVSDILATGGTVLGTSNTASPFAWHGQDVSQAVLAYARELGLQALVAIGGDGTM
TMAHGLAQRGLPVVGVPKTIDNDIAHNERSFGFDTAVATVTEALERVQTTGQSHGRVMIV
ETMGRYAGWIALEAGMAGAADVILIPELPYSVEAIAAVCRERSRARRCTVICIAEGAAVA
GGGMTIERTVADSPDPLRLGGVGHVLRAQLQPLIEAEVRATVLGHVQRGGSPTPFDRVLA
TQYGNAAAQLVLRGEYNRMVTLQHGAMTSVDLASVAGRNRTVPTDHPLLVCARQIGVCLG
QG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacaacagattcccagaaccccgccccgcgcatcggcgtgctgaccggcggc
ggcgactgtccgggactgaacgcggtgatacgcgcggtcaccaaatcgctgatctaccag
tgcggcgccgaggtgatcggcgtcgaggacggcttcctgggcctgatcgaacaccgcgtg
cgcccgctcgactggcgctcggtcagcgacatcctggccaccggcggcacggtgctcggc
accagcaacaccgccagcccgttcgcctggcacggccaggacgtgtcgcaggccgtgctc
gcctacgctcgcgagctcggcctgcaggcgctggtggccatcggcggcgacggcaccatg
acgatggcgcacggcctggcgcagcgcggcctgccggtggtcggcgtgcccaagacgatc
gacaacgacatcgcccacaacgagcgcagcttcggtttcgacaccgcggtggccaccgtg
accgaggcgctcgaacgcgtgcagaccaccggccagagccacggtcgggtcatgatcgtc
gagaccatgggccgctacgccggctggatcgcgctggaggccggcatggccggggcggcc
gacgtgatcctgattcccgagctgccctacagcgtcgaggcgatcgcggcggtctgccgt
gagcgctcgcgcgctcggcgctgcaccgtgatctgcatcgccgaaggcgccgcggtggcc
ggtggcggcatgaccatcgagcgcaccgtggccgacagccccgatccgctgcgcctgggc
ggcgtcggccatgtgctgcgcgcgcagctgcagccgctgatcgaggccgaggtgcgcgcc
acggtgctcggccacgtgcagcgcggcggcagcccgacgccgttcgaccgcgtgctggcc
acgcaatacggcaacgccgccgcccagctggtgctgcgcggcgaatacaaccgcatggtg
acgctgcagcacggcgcgatgacgagcgtcgatctcgccagcgtggctggccgcaaccgc
accgtgccgaccgaccacccgctgctggtgtgcgcgcggcagatcggcgtctgcctgggt
cagggttga

DBGET integrated database retrieval system