KEGG   Leptothrix cholodnii: Lcho_3976Help
Entry
Lcho_3976         CDS       T00681                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
lch  Leptothrix cholodnii
Pathway
lch00010  Glycolysis / Gluconeogenesis
lch00030  Pentose phosphate pathway
lch00051  Fructose and mannose metabolism
lch00052  Galactose metabolism
lch00680  Methane metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_3976
   00030 Pentose phosphate pathway
    Lcho_3976
   00051 Fructose and mannose metabolism
    Lcho_3976
   00052 Galactose metabolism
    Lcho_3976
  Energy metabolism
   00680 Methane metabolism
    Lcho_3976
Enzymes [BR:lch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lcho_3976
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Lcho_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACB36230
JGI: Lcho3976
UniProt: B1Y8G4
Position
complement(4462390..4463478)
Genome map
AA seq 362 aa AA seqDB search
MSQTTDSQNPAPRIGVLTGGGDCPGLNAVIRAVTKSLIYQCGAEVIGVEDGFLGLIEHRV
RPLDWRSVSDILATGGTVLGTSNTASPFAWHGQDVSQAVLAYARELGLQALVAIGGDGTM
TMAHGLAQRGLPVVGVPKTIDNDIAHNERSFGFDTAVATVTEALERVQTTGQSHGRVMIV
ETMGRYAGWIALEAGMAGAADVILIPELPYSVEAIAAVCRERSRARRCTVICIAEGAAVA
GGGMTIERTVADSPDPLRLGGVGHVLRAQLQPLIEAEVRATVLGHVQRGGSPTPFDRVLA
TQYGNAAAQLVLRGEYNRMVTLQHGAMTSVDLASVAGRNRTVPTDHPLLVCARQIGVCLG
QG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacaacagattcccagaaccccgccccgcgcatcggcgtgctgaccggcggc
ggcgactgtccgggactgaacgcggtgatacgcgcggtcaccaaatcgctgatctaccag
tgcggcgccgaggtgatcggcgtcgaggacggcttcctgggcctgatcgaacaccgcgtg
cgcccgctcgactggcgctcggtcagcgacatcctggccaccggcggcacggtgctcggc
accagcaacaccgccagcccgttcgcctggcacggccaggacgtgtcgcaggccgtgctc
gcctacgctcgcgagctcggcctgcaggcgctggtggccatcggcggcgacggcaccatg
acgatggcgcacggcctggcgcagcgcggcctgccggtggtcggcgtgcccaagacgatc
gacaacgacatcgcccacaacgagcgcagcttcggtttcgacaccgcggtggccaccgtg
accgaggcgctcgaacgcgtgcagaccaccggccagagccacggtcgggtcatgatcgtc
gagaccatgggccgctacgccggctggatcgcgctggaggccggcatggccggggcggcc
gacgtgatcctgattcccgagctgccctacagcgtcgaggcgatcgcggcggtctgccgt
gagcgctcgcgcgctcggcgctgcaccgtgatctgcatcgccgaaggcgccgcggtggcc
ggtggcggcatgaccatcgagcgcaccgtggccgacagccccgatccgctgcgcctgggc
ggcgtcggccatgtgctgcgcgcgcagctgcagccgctgatcgaggccgaggtgcgcgcc
acggtgctcggccacgtgcagcgcggcggcagcccgacgccgttcgaccgcgtgctggcc
acgcaatacggcaacgccgccgcccagctggtgctgcgcggcgaatacaaccgcatggtg
acgctgcagcacggcgcgatgacgagcgtcgatctcgccagcgtggctggccgcaaccgc
accgtgccgaccgaccacccgctgctggtgtgcgcgcggcagatcggcgtctgcctgggt
cagggttga

DBGET integrated database retrieval system