KEGG   Leuconostoc citreum: LCK_00073Help
Entry
LCK_00073         CDS       T00663                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lci  Leuconostoc citreum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lci00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lci00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
72900..73925
Genome map
AA seq 341 aa AA seqDB search
MKSSITKFGEHNGQTVLMYTLINEHGTRLSVLNFAGIWHEFSVLDGNKRVNLLLSSPTMI
GYTNNNYYINRLIGRVAGRIKDAKYQYQGKTVVTPKNDGLNSLHGGDNGWANTFFNVTMT
PESIVLKAKITSAQDGFPGTLDSTIEYLLTSDNQVMIKMTGTQSLVDGVFNPTVHAYFNL
GETSNILNHILQLKSDNHLALAVDKVPIGTLSPNQGAYDLAYSSSLKRPLIQLKNTTSEQ
GFDDVFVMNQSAGKTVAILKDTVSSRTIEIKSKRNGLVVFTANTMTADIPTNHGQGRRWI
AVALEPQTLPNSENIPEFGDVTLKSGETRQEVIIYQYHQSF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaagtattaccaaatttggagaacataatggtcaaaccgttttaatgtatacg
cttataaatgaacatggtacgcgtttaagtgtgttaaattttgcaggtatttggcacgag
tttagcgtactggacggtaataaacgtgtgaatttactactatcgtcacctacgatgatt
ggttatacaaataataattattatattaatcggctcattggccgcgttgccggacgaatt
aaagatgcaaagtaccagtatcaaggcaaaacagttgtcacgccaaaaaatgatggtctt
aattctttacatggtggtgataatggttgggcaaatactttttttaacgtgacaatgacc
ccggaaagcattgtgttaaaagctaaaatcacttcagcgcaggatggttttccaggcact
ttagatagtactattgagtatctactgacgtcagataaccaagtgatgattaagatgact
ggaacgcagagtttagtagatggtgtctttaatccaacggtccacgcgtattttaatttg
ggtgaaacaagtaatattttgaatcatatattgcagttaaaatcggataatcatttagca
ttggctgtagataaagtaccaattggtactttatcgccaaatcaaggggcatatgatttg
gcatatagttcaagtttgaaacgaccacttattcagttaaaaaatacgacatcagaacaa
ggattcgatgatgtatttgtgatgaatcaatctgcaggaaaaacagttgctatcttgaag
gatactgtgagttcgcgtacaatagaaataaaatctaaacgaaatggccttgtggttttt
acggctaataccatgacagccgatataccaactaaccacggtcagggtcggcgatggata
gcagttgccttggaaccacagacattaccaaatagtgaaaacatccccgaatttggagac
gtgacactaaaatccggcgagacacgtcaggaagttattatctaccaatatcatcagtca
ttctaa

DBGET integrated database retrieval system