KEGG   Leuconostoc citreum: LCK_00119Help
Entry
LCK_00119         CDS       T00663                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lci  Leuconostoc citreum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LCK_00119 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCK_00119 (adhE)
   00620 Pyruvate metabolism
    LCK_00119 (adhE)
   00650 Butanoate metabolism
    LCK_00119 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LCK_00119 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LCK_00119 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LCK_00119 (adhE)
   00626 Naphthalene degradation
    LCK_00119 (adhE)
Enzymes [BR:lci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LCK_00119 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LCK_00119 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115132..117834
Genome map
AA seq 900 aa AA seqDB search
MVEATTKKPVKKVLTPEEKAVLQTQAEKMTAELVEKSQKALAEFSTFTQEQVDKIVAAMA
LAGSENSLLLAHEAHDETGRGVVEDKDTKNRFASESVYNAIKYDKTVGVINEDKIQGKVE
LAAPLGVLAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQAQKSSSHAAQIVYEAALK
AGAPENFIQWIEKPSIYGTSALIQNTGIASILATGGPSMVNAALKSGNPSMGVGAGNGAV
YIDGTVDTDRAVSDLLLSKRFDNGMICATENSAVIQASVYDDVLQKLQDQGAYLVPKKDY
KKIADYVFKPNAEGFGVAGPVAGMSGRWIAEQAGVKIPEGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVTERQEAIDTVQALLNYQGAGHNAAIQIGSQDDPFIKSYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWIRL
PKEVYYEANAITYLQDLPSVKRAFIVADPGMVEFGFVGKVLSQLELRQEQVETNIYGSVK
PDPTLSQAVDIARQMADFKPDTVILLGGGSALDAGKIGRFLYEYSTRHEGILSDEEGIKE
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDHTHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHAFESYVSVMASEFTRPWALQAIKLIFEN
LTTSYKYDPKQPTKEGQNARTKMHYASTLAGMSFANAFLGINHSLAHKTGGEFGLPHGLA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLQGTTDAELVDALIVAI
KALAKSVEVDQTLSGNGVKKADLEKNIDQLTDLVYNDQCTPGNPRQPSLAEIKQLLMDQL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagcaacaacaaagaagccagtcaaaaaggttttgacgcccgaagaaaaagcg
gtattacaaactcaggcagaaaaaatgacggcagaactagttgaaaagtcacaaaaagct
ttagctgagttttcaacattcacgcaagaacaagtggataaaattgttgcagcaatggca
ttagctggatcagaaaattcattgttattggctcacgaagcacacgacgaaactggtcgt
ggtgttgtcgaagataaagacaccaagaatcgttttgcatctgaatcagtatataacgct
atcaaatatgacaagaccgttggtgttattaatgaagataaaattcaaggaaaggttgaa
ttagctgcgccacttggtgttttagctggtattgtgccaacaactaacccaacatcgaca
actattttcaagtcaatgctcacagcgaagacacgtaatacaattatctttgctttccat
ccacaggcacagaaatcatcatcacatgctgcacaaattgtttatgaagcagccttaaag
gctggtgcacctgaaaacttcattcaatggattgaaaagccatcaatctatggcacaagt
gcgttaattcaaaatacgggtattgcatcaatcctagcaactggtggcccatcaatggtt
aatgcagccttgaaatcaggtaatccatcaatgggtgttggggcaggtaacggtgcagtt
tatattgacggtacggtagatactgatcgtgctgtttcagatttgttgttatcaaagcgt
tttgataatggtatgatctgtgccacagaaaactcagcagttattcaagcttcagtctat
gacgacgtgttgcaaaagttgcaagatcaaggggcttacctcgtacctaaaaaagattac
aagaaaatcgcggactatgtttttaagccgaatgctgaaggttttggtgtagcaggtcct
gttgccggcatgtcaggccgttggattgcagaacaagctggcgttaagattcctgaaggc
aaagatgttttgctgtttgaattggatcaaaagaacattggcgaggctttatcatcagaa
aagttgtcaccattattgtcaatttacaaggtcacagaacgccaagaagcaatcgataca
gtacaagcattgttgaattatcaaggtgcaggacataacgcagcgattcaaattggctca
caagacgatccgtttattaagtcatatgctgacgccattggggcatcacgtattttggtt
aaccagccagactcaattggcggtgttggtgatatttatacagatgccatgcgcccatca
ttaacgcttggtaccggatcatgggggaagaattcattgtctcacaacttgtcaacatac
gatttactcaacattaaaactgtggcacgtcgtcgtaatcggccacaatggatccgtttg
ccaaaggaagtttactatgaagcaaacgcaattacctacctgcaagacttaccatcagtt
aagcgtgcctttatcgtcgccgaccctggtatggtagaattcggctttgttggtaaggtt
ttgagtcaacttgagcttcgccaagaacaagttgaaacgaacatttatggatcagttaag
ccagatccaacattgtcacaggctgttgacattgcccgccaaatggctgattttaagccc
gatacagtgattttacttggtggtggttcagccttagatgccggtaagattggtcgcttc
ttgtatgaatactcaacgcgtcatgagggtattttatcagatgaagaaggtatcaaagag
ttattcatggaattgcaacaaaagttcatggatattcgtaagcgtattgttaagttctat
catgcacgtttgacacaaatggtggcgattcctacgacatcaggaactggttcagaagtg
acaccatttgccgttatcacagatgaccatactcatgtgaagtaccccttggctgattat
gaattgacgcctgaagtggctattgtcgatcctgaatttgtcatgacagtaccaaagcgt
acagtagccttttctgggttggatgctttgtcacatgcctttgaatcatatgtatcagtc
atggcttcagagttcacacgaccatgggcattgcaagcaattaagctaatttttgaaaac
ctcacaacatcttacaagtatgatccaaagcagccaaccaaagaaggacagaacgcacgt
acaaaaatgcattacgcttcaactttggcaggtatgtcatttgccaatgccttcttaggc
attaatcactcacttgcacacaaaacaggtggtgagttcggtttgccacatggtttggcc
attgcgattgcaatgccacatgtgattaagtttaatgctgtaacaggtaacgttaagcgt
acaccatacccacgctacgaaacttacacagcacaaaaggactatgcagacattgcgcgt
tacttaggtttgcaagggacgacagatgctgaattggttgatgccttaatcgtagcgatt
aaagcattagcaaagtcggtagaagttgaccaaacattgtcaggaaatggagttaaaaaa
gctgaccttgaaaagaatatcgatcagttgactgaccttgtatataatgaccagtgcaca
cctggtaacccacgccaaccaagtttggctgaaatcaagcaattattgatggatcaactt
taa

DBGET integrated database retrieval system