KEGG   Leuconostoc citreum: LCK_00126Help
Entry
LCK_00126         CDS       T00663                                 

Definition
phospho-beta-galactosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lci  Leuconostoc citreum
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lci00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125198..126682
Genome map
AA seq 494 aa AA seqDB search
MMTKKGLQLPSDFLWGGAIAAHQAEGYWDADGKGVSIADVLTAGSHEKPREITDGVLPDK
NYPNHHGIYFYKTYKEDLALMAEMGFKAFRTSIAWTRIFPNGDDAEPNEAGLKFYDDMFD
TMHELGIEPVITLNHFEMPYHLVTAYGGWQNRQVIDFFEKYARVVFERYRNKVTYWITHN
EISNQANQAEISGFSDFLVWTNSGLKFDAETTVSERQAAMYQAAHNELVASARAVRIGHE
INPDFQIGAMLNVGSLYPASTKPADQLAVQKARQQRDWFSDVHIRGAYPNEMEKLFERTG
WRSDVTDQDFIDLASGTVDYLSISYYASSVIRAKQDDDSELDEAANWETVPNTNIKASDW
GWSIDPQGLRYTLNELNDLYPDLPIMIVENGFGAYDELVEANGQPTVNDDYRIAYLAAHI
AEVEKAIVHDGIPVIGYLSWGPIDIVSAGTGEMKKRYGYVYVDLDDFGEGSAKRYKKASF
KWYQELIASGGTRL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaaaaaaggtttacaattaccgtcagattttttgtggggtggcgctattgct
gcacatcaggcagaaggctattgggatgctgatggtaaaggtgtttcgattgctgacgta
ttaacggcaggatcacatgaaaagcctcgtgagattactgatggcgtcttaccagacaaa
aactatccaaatcatcatggtatctatttctataaaacatataaggaagacttggctttg
atggcggaaatgggcttcaaagcatttagaacttctattgcttggacacgtatttttcca
aacggtgatgatgctgaacctaatgaggcaggtttaaaattttatgatgatatgtttgat
accatgcatgaattaggtatcgagccagttatcacgctaaatcattttgaaatgccttat
catctagttaccgcatatggtggttggcaaaatcgacaggtgattgacttttttgaaaag
tatgcgcgtgtggtgtttgaacgttatcgcaacaaagtaacttattggattacgcataac
gaaatttcgaaccaagcgaatcaagcagaaataagtggcttttctgattttctggtttgg
accaattctggtttgaaatttgatgcagagacaacagtctcagaacgtcaagcagcgatg
taccaggccgcacataatgagttggtggctagcgcacgtgctgttcgcataggtcatgag
attaatcctgattttcagattggggcgatgctgaatgttggcagcttgtatccagcttcc
acaaagccggctgatcagctggcagtgcaaaaagcgcggcaacagcgtgactggttcagt
gatgttcacatccgtggcgcttatccaaacgaaatggaaaagctttttgaacgtacgggt
tggcgatcagatgttacggatcaagattttattgatttggcctctggtacggtagattat
ttgagtatttcatattatgcttcttctgtgattcgtgccaagcaggatgatgactcggaa
ttggacgaggcagcgaactgggaaacggtgccaaataccaatattaaagccagtgattgg
ggttggtcaattgatccacaggggttacgctataccttaaatgaattgaatgatttgtat
cccgaccttcccatcatgattgttgaaaatggatttggtgcctacgatgaactggttgag
gcaaatggtcagcctacggttaatgatgattatcgtatcgcttacttggcagcccatatt
gccgaggttgaaaaggcaattgttcatgatggtattccagttattggctatctgtcatgg
ggaccgattgacattgtgtcggctggtactggtgaaatgaagaagcgctatggttacgta
tatgttgacttagatgattttggtgaaggtagcgctaagcgatacaaaaaagcgagtttc
aagtggtatcaagagttgattgccagcggtggaacgagactgtag

DBGET integrated database retrieval system