KEGG   Leuconostoc citreum: LCK_00160Help
Entry
LCK_00160         CDS       T00663                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lci  Leuconostoc citreum
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lci00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
165095..166591
Genome map
AA seq 498 aa AA seqDB search
MTEDIRVRYAPSPTGHLHIGNARTAIFNWLFARHYNGKFIIRIEDTDSARNIADGEKSQL
ENLAWLGLDWDESPEKPGEYGPYRQSERNEQGIYQPFIDKLLTEGLAYKSYKTSEQLASE
REAQQAAKQAPHYVYEYEGLTREEREAKYAEFEAKGLKPVVRFRVPEEKTYAWDDIVKGH
IEIGAKEVGGDWVIQKADGMPTYNFAVVVDDHMMKISHVLRGDDHVSNTPKQMMIFEALG
WDIPQFGHMALIINGETGKKLSKRDENVLQFVEQYKALGYQPQAMVNFIGLLGWSPKGED
EIFSLEEFKQMFDETRLSKANAKFDQKKLEWINNQWMRRDLEEIMPQLIQELVTANLVSP
ADATAKADWLAQVIKVAGVEGISYTREIVDLVRQPFFELGDITDEMVAYLTSEEGRRVFD
AWESAYIALPDDATAEDYLNAIRGIQNQLEIKGRNLWNPIRIATTHEVQGPNLPEMLVVL
DKATVLQTMADVKSNYLN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagatattcgtgttcgctacgcaccatcaccaactggccatttacatattggt
aatgcgcgtacagctatttttaactggctttttgctcgccattataatggtaaatttatt
attcgtattgaagatacagattcagcccgtaatattgctgatggcgaaaaatctcagtta
gaaaacttagcttggctcggtttagactgggatgaatcaccggaaaagccaggtgaatat
ggaccttatcgccaatctgagcgtaatgagcagggtatttaccaaccgtttattgataag
ttgttgactgaagggttggcatataaatcttataaaacgtcggaacaactagcttctgaa
cgtgaagctcagcaagcagccaagcaagccccgcattatgtttacgaatatgaaggttta
acacgtgaagaacgtgaggcaaagtatgccgaatttgaagcaaagggtctaaagccagtg
gttcgtttccgtgtgccagaagaaaagacttacgcttgggatgatattgttaaaggacac
attgaaattggtgccaaagaagttggaggcgattgggtcattcaaaaagccgatggcatg
ccaacatacaattttgcagttgtagttgatgaccacatgatgaagatttcgcatgtgttg
cgtggtgatgatcacgtgtctaacacccccaagcaaatgatgatatttgaagcgcttggt
tgggatataccacaatttggtcatatggcgctgattatcaatggtgagacaggtaaaaag
ttatcaaaacgtgacgaaaacgtcttacaattcgttgaacaatacaaagcattaggttat
caaccacaagcaatggtcaactttattggtttactaggttggtcaccaaagggtgaagac
gaaattttctcactagaagaatttaagcaaatgtttgacgaaacccgcctgtcaaaggca
aatgcgaagtttgatcaaaagaagttggaatggattaataaccagtggatgcgccgtgat
ttagaagaaattatgccacaattaattcaagaattagtgactgctaatcttgttagtcct
gctgatgcaacagctaaggcagattggttagctcaggtgattaaggtggctggtgttgaa
ggcatttcttatacgcgtgaaatagttgacctagtacgtcagcctttctttgaattaggt
gatattactgatgagatggtggcttacttaacctccgaagaaggtcgtcgcgtgtttgat
gcatgggaatcagcttacatcgcactacctgatgatgcgacagcagaagattacctgaat
gcgattcgtggtattcaaaatcagctcgaaattaaaggccgtaatctctggaatcctatt
cgtattgcgacaacacatgaagttcagggaccaaatcttcctgaaatgctagttgtttta
gataaggcaaccgtattacaaacaatggctgatgttaaatcaaattatctgaattaa

DBGET integrated database retrieval system