KEGG   Leuconostoc citreum: LCK_00162Help
Entry
LCK_00162         CDS       T00663                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lci  Leuconostoc citreum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LCK_00162 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCK_00162 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    LCK_00162 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LCK_00162 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LCK_00162 (adhA)
   00626 Naphthalene degradation
    LCK_00162 (adhA)
Enzymes [BR:lci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LCK_00162 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
167784..168839
Genome map
AA seq 351 aa AA seqDB search
MKAAVVRENPDGYVDLIDNWEPKALSFGEALVDMEYVGLCHTDLHVAGADFGNPNKIGQR
NGAFRRVIGHEGVGRVSKLAEGAGDYLKIGDRVSIAWFYDACGVCDYCVTGNETFCRKVR
NSGYTVDGAMSQQAVVNAKYAVKVPEGLDPVEATSITCAGVTMYKSLKVGETKPGQWVSV
HGAGGLGNLAVQYAHNVFGAHVAIIDGNDDKLAAAKENGAEVLINRKKVEDVAAEVQKAT
GGVHTAQVTAVNAAAFNQAVDSLRPMGKLVAVALPQGDMALNIAKTVLDGIEVRGSLVGT
RADLKEAFQFGAEGKVKPIVEKVNFADMNEIIDEMKAGKITGRKVFDFTTL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttgtacgtgaaaacccagatggttacgttgatttaattgataattgg
gaaccaaaagctttgtcatttggtgaagccctagttgatatggaatatgttggtctttgc
catacagacttgcacgtagccggtgccgattttgggaatcctaataaaattggacaacga
aacggtgcgttccgccgtgtaatcggacatgaaggtgttggtcgtgtgtcaaagttagca
gaaggtgctggtgattacttgaagatcggtgatcgtgtatctattgcttggttttatgat
gcttgtggcgtttgtgattattgtgtaacgggaaatgagacattttgtcgtaaagttcgg
aattcaggctacacggttgatggtgctatgtcacaacaggcagtggttaatgctaagtat
gctgttaaagtgcctgaaggcttggatccagttgaagctacgtcaattacctgtgctggt
gtgacaatgtataagtcacttaaagtcggtgaaacaaaaccaggtcagtgggtatctgtt
catggtgccggtggtttaggtaacttagctgttcagtatgcgcacaacgtgtttggcgca
catgtggctatcattgatggtaatgatgataagcttgctgcagcaaaagagaatggtgct
gaagtcctaatcaaccgtaaaaaggttgaagatgtggctgctgaagtacaaaaagcaacc
ggtggtgtccatactgcacaagtgaccgcagttaacgcagctgcatttaatcaagcagtt
gactcactacgccctatgggtaagttagttgctgtggccttgccacaaggtgacatggct
ttgaatattgctaagaccgtcttagatggtattgaagttcgtgggtcattagtaggtaca
cgtgctgatttgaaagaagctttccaatttggtgcagaaggcaaagttaagccaattgtt
gagaaagttaactttgcagacatgaacgaaatcattgatgagatgaaagctggtaaaatt
accggacgtaaagtctttgatttcacaacactttaa

DBGET integrated database retrieval system