KEGG   Leuconostoc citreum: LCK_00177Help
Entry
LCK_00177         CDS       T00663                                 

Gene name
ptk
Definition
putative phosphoketolase (EC:4.1.2.-)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lci  Leuconostoc citreum
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCK_00177 (ptk)
Enzymes [BR:lci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LCK_00177 (ptk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
181964..184417
Genome map
AA seq 817 aa AA seqDB search
MADFDSKEYLELVDKWWRATNYLSAGMIFLKSNPLFSVTNTPIQAEDVKVKPIGHWGTIS
GQTFLYAHANRLINKYDLNMFYIGGPGHGGQVMVTNAYLDGEYTEDYPEITQDLEGMSRL
FKRFSFPGGIGSHMTAQTPGSLHEGGELGYSLSHAFGAVLDNPDQIAFAVVGDGEAETGP
SMTSWHSTKFLNAKNDGAVLPILDLNGFKISNPTIFSRMSDEEITKFFEGLGYSPRFIEN
DDIHDYAAYHELAAKVLDQAIEDIQAIQKDARENGKYEDGTIPAWPVIIARLPKGWGGPT
HDEDGNPIENSFRAHQVPLPLAQNKLETLSQFEDWMNSYKPEELFNADGSLKDELKAIAP
KGDKRMSANPIANGGRRRGEEATDLTLPDWRQFTNDITNENRGHELPKVTQNMDMTTLSN
YLEEVAKLNPTSFRVFGPDETMSNRLWSLFNTTNRQWMEEVKEPNDQYVGPEGRIIDSQL
SEHQAEGWLEGYTLTGRVGIFASYESFLRVVDTMVTQHFKWLRHASEQAWRNDYPSLNLI
ATSTAFQQDHNGYTHQDPGMLTHLAEKKSNFIREYLPADGNSLLAVQDRAFSERHKVNLI
IASKQPRQQWFTADEADELANEGLKIIDWASTAPSGDVDITFASSGTEPTIETLAALWLI
NQAFPEVKFRYVNVVELLRLQKKSESHMNDERELSDAEFNKFFQADKPVIFGFHAYEDLI
ESFFFERKFKGDVYVHGYREDGDITTTYDMRVYSKLDRFHQAKEAAEILSANSTIDQAAA
DTFIEKMDATLAKHFEVTRNEGRDIEEFTDWNWSALK
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttcgattcaaaagagtacttggaactcgttgataagtggtggcgtgcaact
aactatttgtcagcagggatgatcttcttgaagagcaacccattgttctcagttactaac
acaccaatccaagccgaagacgttaaagttaagcctatcggtcactggggaactatttca
ggtcaaacattcttgtatgcacacgcaaaccgtttgattaacaagtatgacttgaacatg
ttctacatcggtggaccaggacacggtggccaagtaatggttactaatgcctacttggat
ggcgaatatactgaagattacccagaaatcactcaagatttggaaggtatgagccgcttg
ttcaagcgtttctcattccctggcggaatcggatcacacatgacagcacaaacaccaggt
tcattacatgaaggtggtgaattgggttattcattgtcacacgcctttggtgctgttttg
gacaatcctgatcaaattgcttttgctgttgttggtgatggtgaagccgaaacaggccca
tcaatgacatcatggcactcaacaaagttcttgaatgctaagaatgatggtgctgttttg
ccaatcttggatttgaacggatttaagatttctaacccaacaatcttctcacgtatgagt
gatgaagaaatcacaaagttctttgaaggtttgggttactcacctcgctttatcgaaaat
gatgacatccatgactatgcagcttatcacgaattggctgctaaggttttggatcaagct
attgaagatattcaagctatccaaaaggatgcgcgtgaaaacggtaagtacgaagatggt
acaatcccagcatggcctgtaattattgcacgcttgccaaagggttggggtggaccaaca
catgatgaagatggtaaccctatcgaaaattcattccgtgctcaccaagtgccattgcct
ttggcacaaaataagttagaaacattgtcacaattcgaagactggatgaattcatacaag
ccagaagaattgttcaatgctgatggttcattaaaagatgaattgaaagctattgcacct
aagggtgacaagcgtatgtcagctaacccaatcgctaacggcggacgtcgtcgtggtgaa
gaagcgacggatttgacattgccagattggcgtcaattcacaaatgacattacaaatgag
aatcgtggacacgagttgccaaaggttactcaaaacatggatatgacaacactttcaaac
tacttggaagaagttgctaagttgaacccaacatcattccgtgtctttggacctgatgaa
acaatgtcaaaccgtttgtggagtctctttaacacaactaaccgtcaatggatggaagaa
gttaaggaaccaaatgatcaatatgttggcccagaaggtcgtatcattgactcgcaattg
tcagagcaccaagctgaaggttggcttgaaggctacacattgactggccgcgttggtatc
tttgcttcatacgagtcattcttgcgtgttgtggatacaatggttacacaacacttcaag
tggttgcgtcacgcctcagaacaagcatggcgtaatgattatccatcattgaacttgatt
gcgacgtcgactgcgttccaacaagatcacaatggttacacacaccaagatccaggtatg
ttgactcatttggctgaaaagaagtctaacttcattcgtgaatacttgcctgcagatggt
aactcattgttggctgttcaagatcgtgcgttctcagaacgtcacaaggttaacttgatt
attgcttctaagcaaccacgtcaacaatggtttactgctgatgaagctgatgaattagct
aatgaaggtttgaagattattgattgggcttctactgcaccatctggtgatgttgatatt
acattcgcatcatctggtacagaaccaacaatcgagacacttgctgccttgtggttgatt
aaccaagccttcccagaagtaaagttccgttatgttaacgttgttgaattacttcgtttg
caaaagaagtcagaatctcacatgaatgatgaacgtgaattgtctgacgcagaattcaac
aagttcttccaagctgataagcctgttatctttggtttccacgcttacgaagatttgatt
gaatcattcttcttcgaacgtaagttcaagggtgatgtttatgttcatggttaccgtgaa
gatggtgacatcacaacaacttatgacatgcgtgtttactcaaagttggatcgtttccac
caagctaaggaagctgccgaaattttgtcagctaatagcacaattgatcaagcagctgct
gatacatttatcgaaaagatggatgctactttggcaaagcatttcgaagttactcgtaac
gaaggtcgcgatatcgaagaatttactgattggaattggtcagctttgaagtaa

DBGET integrated database retrieval system