KEGG   Leuconostoc citreum: LCK_00220Help
Entry
LCK_00220         CDS       T00663                                 

Gene name
gmk1
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lci  Leuconostoc citreum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCK_00220 (gmk1)
Enzymes [BR:lci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LCK_00220 (gmk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
228889..229479
Genome map
AA seq 196 aa AA seqDB search
MKDNKVFVITGATGVGKTTIARYLQENYRMPRVITHTTRRPREREVNGIAYYFETDDSFE
NNHYLERVTYAGAKYGSSYEGLDRAWQKSQYITIVLDTAGAITYAQELGSRAIIIFVTVT
SPSVLVDRVQVRGDDPHAVKQRVASPEFLRDMKLPQNLKGRAYELVNDDWSKTKTRLDLL
VTDIMHGRRLPKKQLE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataacaaagtatttgtcatcactggtgcgacaggtgttggcaaaaccacaatt
gcccgctatttacaagaaaattatcgtatgcctcgtgtgattacacatacaacacgtcga
ccaagagaacgtgaagtgaatggtattgcctactactttgaaacggatgattcttttgag
aataatcattatttagaacgtgtgacctatgcaggggctaaatacggttcgtcgtatgaa
ggactagaccgtgcatggcagaaaagccaatatattaccattgtcttggatacagctggt
gcaattacttatgcacaagaattgggatcacgggcgattattatttttgtgacggtaact
agtccgtctgttttggtcgaccgcgtgcaagtgcgaggggatgatccacatgctgtcaaa
caacgtgttgcctcacctgaatttttgagagatatgaagttgccgcagaatctcaagggg
agagcgtatgaattagtgaacgatgactggtcaaagacaaaaacaagactagatttactt
gtgacagatataatgcatggtcgtcgtttgccaaaaaaacaattagaataa

DBGET integrated database retrieval system