KEGG   Leuconostoc citreum: LCK_00286Help
Entry
LCK_00286         CDS       T00663                                 

Gene name
proB
Definition
(GenBank) Gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lci  Leuconostoc citreum
Pathway
lci00330  Arginine and proline metabolism
lci00332  Carbapenem biosynthesis
lci01100  Metabolic pathways
lci01130  Biosynthesis of antibiotics
lci01230  Biosynthesis of amino acids
Module
lci_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LCK_00286 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LCK_00286 (proB)
Enzymes [BR:lci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LCK_00286 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DRE2_N HEM4 DUF3983
Motif
Other DBs
NCBI-ProteinID: ACA82119
UniProt: B1MX67
Position
301785..302600
Genome map
AA seq 271 aa AA seqDB search
MQLSRSDIQSDKAWRRIVVKVGTSTIVDATGDIKYPVINRLAQTLTQLQKSNYDVILVTS
GAIGVALNQMNSRTRPTDIPAQQALAAIGQSYLMAIYNQSFAFYQQHVGQVLLTYDVFNN
KQMLRHTIDAIEAMLRQNVIPIINENDVIAVDELDHQHSFGDNDRLAAIVTHETAADSLV
VLSDIDALYTANPHVNPNAQAIPLVSEVTAELLAGANGSSTLGTGGMATKLYAADYLLKR
ARQMVLINGENPATILDVVNGKQVGTLFKGV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaattatcacggtcagacattcaatctgataaagcgtggcgacgcattgtcgttaaa
gttggtaccagtactattgttgatgctactggcgatattaagtatccagtaattaatcgt
ttagcacaaacactcacacagctacaaaaatcaaattatgatgttattttagttacttcc
ggtgccattggcgttgcattaaatcagatgaatagtcgcacacggccaactgacattcct
gcgcaacaagcacttgcagctattgggcaaagctatttaatggcaatttataatcagagt
tttgctttttatcaacaacatgttggacaggtacttttaacctatgatgttttcaacaat
aagcaaatgttacgtcatacaatcgatgccattgaggctatgttgcgtcaaaatgttatt
ccgattattaatgagaatgatgttattgcggttgatgagttagaccaccaacactctttt
ggtgataatgatcgcctagcagcaattgtgacacatgagacagctgctgatagtcttgtg
gtcctaagcgatattgatgcgttatacacagctaatccacacgtcaacccaaatgcacag
gcgatcccactagtgtctgaagtgacagctgaattgttggctggtgctaatggctcatca
acactaggaacgggtggaatggccactaaattgtatgcagccgattatttattaaaacga
gcacgccaaatggtattaattaatggcgaaaatcccgctacaatattagatgtagttaac
ggaaaacaagttggtactttatttaaaggagtttaa

DBGET integrated database retrieval system