KEGG   Leuconostoc citreum: LCK_00486Help
Entry
LCK_00486         CDS       T00663                                 

Gene name
pgm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lci  Leuconostoc citreum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCK_00486 (pgm)
   01230 Biosynthesis of amino acids
    LCK_00486 (pgm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCK_00486 (pgm)
  Energy metabolism
   00680 Methane metabolism
    LCK_00486 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCK_00486 (pgm)
Enzymes [BR:lci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCK_00486 (pgm)
Exosome [BR:lci04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCK_00486 (pgm)
  Exosomal proteins of melanoma cells
   LCK_00486 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
512021..512701
Genome map
AA seq 226 aa AA seqDB search
MVAQLVLVRHGESTANRDNQFTGWTDVPLTAKGRAQAKKVGQLLADKAMTFDDVHTSYLQ
RAISTANIILYESHQSWVPIHKTWRLNERHYGALRGLNKDAARQKYGVSAVQLWRRSYTA
VPPLLDRVTPDRRYPNQIEPLGESLAMASDRLLPYWHSTIEPALRAGRHQLVVAHGSSLR
ALIKYLENISDEAIDGLEVGNGEPICYTFNEKFEISPRQYLQADVK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggtagcacaacttgtgttagttcgtcatggggagtcaaccgctaatcgcgataatcaa
tttactgggtggacagatgtaccacttactgcaaaggggcgtgcacaagcaaaaaaggta
ggacaattattggctgataaagcaatgacctttgatgatgtccatacatcctatttacag
cgtgcgatttcaacggctaacattattttatatgagtctcatcagtcttgggtgccaatc
cataaaacttggcgtttaaatgaacggcattatggtgcgctccgtggtttaaataaggat
gcagcacgtcagaaatatggtgtttcggctgtacaattatggcgaagaagttatacagcc
gtgccaccgttattagatcgtgtgacaccagaccgccgctatcctaaccaaatcgagcca
ctcggagaaagtttagcaatggccagtgatcgcttattaccttattggcattctacgatt
gaaccggcgctacgtgctggtcgtcatcagcttgtggtggcacatggcagttcattacgg
gcactgattaaatacttagaaaatattagtgatgaagccatcgatggcttagaagttggc
aatggtgaaccaatttgttacacatttaatgaaaaatttgaaattagtccacgccagtac
ctgcaggcagatgttaaataa

DBGET integrated database retrieval system