KEGG   Leuconostoc citreum: LCK_00635Help
Entry
LCK_00635         CDS       T00663                                 

Gene name
rbsK
Definition
ribokinase family sugar kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lci  Leuconostoc citreum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCK_00635 (rbsK)
Enzymes [BR:lci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LCK_00635 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
668427..669371
Genome map
AA seq 314 aa AA seqDB search
MCCRTQHTEIMTKKIVVLGSLNVDNIMKMPRMPLEGETMALTDVTTAPGGKGANQAVASA
RQGAEVSFIGAVGSDANGQFMRATLLTNGVNVDAVTTNGDVPTGSAYIMLQDSGANTILI
HGGANQALTVADLDKTMIADADTLIAQFEVPLDVIIAAFKVAKANGVQTILNPAPAVYDL
TPELMAVTDIILPNETEAQLLSGLTVENDEAVLNRVSDDLLSQGVSRSVITLGDAGSFVA
DGQKRWWAKPNKVKAVDTTAAGDTFIGTLATVIAPDFSNLDDAIHRASVASAIAVTRAGA
IPSIPTSDEVEAFK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgtaggacacaacatactgagatcatgactaaaaaaattgtagttctcggcagc
ttaaatgtcgataatattatgaaaatgccacgtatgccgttagaaggggaaacaatggcg
ttgacagatgtcactactgcacctggtggtaaaggcgctaatcaggcagttgcttctgcg
cgtcaaggcgcagaagtatcgtttataggtgcagtcggcagcgatgctaatggccagttt
atgcgtgcaacgctattaaccaacggtgtgaatgttgatgctgtcaccaccaatggggat
gtccctactggctctgcttatattatgttacaagatagtggggctaacacaatattaatc
cacggtggcgccaatcaagcgcttactgtagctgatttagacaaaacaatgattgctgat
gctgacacactcattgcacagttcgaagtgccgttggatgtcatcattgcagcttttaaa
gttgctaaggctaatggtgttcagacaattctcaacccagcgcctgctgtctatgatttg
acgccagaactcatggcggtaacagatattattttgccaaatgaaacagaagcccaacta
ttatcagggttgactgttgaaaatgatgaagcagtattgaatcgcgtgagtgatgaccta
ttgtctcagggtgtgtcgcgcagtgtcatcaccttaggtgatgctgggtcttttgtggca
gatggtcagaaacgctggtgggcaaaaccaaataaagttaaggcggtagatacaacagct
gctggagatacttttattggcacattggcaacggttattgcacctgatttttctaattta
gatgatgccatacatcgtgcaagtgttgctagtgcaatagctgttactcgggcaggagct
attccttctattccaacaagtgatgaggtagaggcttttaaatga

DBGET integrated database retrieval system