KEGG   Leuconostoc citreum: LCK_00640Help
Entry
LCK_00640         CDS       T00663                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lci  Leuconostoc citreum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lci03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673154..675553
Genome map
AA seq 799 aa AA seqDB search
MVYQEEQQLDKVSGTLQHVIFASNDSYFKILSIQIDDATLNQWDEPEIIATGTFADVQEG
SMYAFYGTIVRHPKYGKQLKVVRYEHEMPPDENGLIKYFASGQFSGIGQKTAEKIVEHLG
LNAVDLILNDATVLDGLVKPATAQKLVRNLQLNLGLERLFQIGNQFGIGADITGRLYDQY
GQEAQDILLHDPYRLVFEFDGISFKVADVVGQQLGIDRLDTKRLQAAVYAAIMNVSFQYG
HTYVTREQLRQISYQLLRENRIDSAIDSAITMLIEQHVLTVDDDKIYATTLYVAENQVAQ
HLTRLVHAPAPIDLTAADVDSGFDTPSQLILDDTQIAAVKAGLNAQVFLLTGGPGTGKTT
IVKSIVATWQKILQHHAKFADNAQDFLKLYAVKMASPTGRAAKRMTEVTGHDATTIHRLL
GITDLGEPEFDNENPISGGLLIIDEASMLDIELTAKLLAAIPSGMKLIIVGDSDQLPSVG
PGNVLADLVNSGILPHIELETIYRQGRGSSITALAQNIKSGRLPEDFLENKHDRSTFMVS
PEQAETAIKQVVQAAIKKNYTQDDLQILTPIYKTSAGVLTLNTMAQALFNPEKATKKSLQ
FGHTYFRKGDKVLQLENDSERDVYNGDMGTIIAVQSKQDKGNEDHEDRLVVDFDGKELAY
TKKDLSQLTLAYATTVHKAQGNEFKLVIMVLTSQFGLMLNRNLLYTGITRAKEALILVGD
YQAFNRAAKTPVPQRATTLKQRLQASIVDNKTSEKTIIKQDEPEKTVLTYQLTAGIISAQ
TIDPMIGMNEVTPDDFMLN
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcaggaagaacaacaattagataaggtatctggtacgttacaacatgtgatt
tttgcgtctaatgactcttatttcaagattttgtctattcaaatagatgatgcaacgtta
aaccaatgggatgaaccagaaattatagctaccgggacatttgctgatgttcaggaaggc
agtatgtatgctttttatggtacaatcgtgcggcacccaaagtatggtaaacaactcaag
gtggtgagatatgagcatgaaatgccgccagacgaaaatggattaattaaatactttgct
agtgggcaattttctggtattggtcaaaaaacagctgaaaaaattgtcgaacatctaggc
ttaaatgctgtagatttaatcttaaatgacgccactgtgttagatggcttagtaaagcct
gcgacagcacaaaagttagtacgtaatttacaattaaatctagggttagaacgactattt
caaattggtaatcaatttggtattggagcagatattactggccgtttatatgatcaatac
ggtcaagaggcacaagatattttgttgcacgacccttatcgtctcgtgtttgaatttgat
ggtatatcatttaaagtagctgatgtagtcggtcaacaattgggcatcgacagattagat
accaaacgtttacaggctgcagtatatgcggccatcatgaatgtgagttttcagtatggc
catacatacgtcacgcgtgaacaactccggcaaataagttatcaattattacgtgaaaat
cggattgactcagctattgattcagcgataacgatgttgattgaacagcatgttttaaca
gttgacgacgataaaatttacgcaacgaccctttatgtcgctgaaaatcaggttgcacag
catttgacacgcttggtccatgcaccagcaccgattgacctaacagcagctgatgttgat
tcagggtttgacacaccaagccaattaatattagatgacacacagattgcggccgtcaaa
gcagggcttaatgcgcaggtgtttttattaactggtggcccgggaactggtaaaaccact
attgttaaatcaattgttgcgacgtggcaaaaaatactacagcaccatgccaaatttgcc
gataacgctcaggattttttaaagttatatgccgttaaaatggcctccccaactggtcga
gcagctaaacggatgactgaagtgactggacatgatgcgacaactattcatcgtttactt
ggaattactgatttgggggagccggaatttgataacgaaaatccaatttccggtggactc
ttaatcatcgatgaagcctcaatgctggatattgagttaacggctaagttgttggcagcc
attcctagtggtatgaaattgattatcgttggtgattcagatcaactaccttccgttggg
ccgggcaatgtcttagctgatttggttaacagtggtattctgccacacattgagcttgaa
acgatttatcgacaaggccgtggtagtagtattaccgcattagcacaaaatattaaaagt
ggccgattacctgaggatttcttagagaataaacatgatcgttccacgttcatggtatca
ccagagcaagcagaaacagcgattaaacaagttgtacaagctgcaattaagaaaaactat
acacaagatgacctacaaatattaacacccatttataaaacatcagctggtgtgctgaca
ttaaatacgatggcacaagcactatttaatccagaaaaggcaacgaaaaagtcactgcaa
tttgggcacacctattttcgtaagggtgataaagttttacagttggaaaacgatagcgag
cgggatgtttacaatggtgacatgggcacaattattgctgttcaatctaaacaagataag
ggcaatgaagatcatgaagaccgtttggtcgttgattttgatggcaaagagttagcatat
actaaaaaagatctcagtcaacttactttggcatacgcgacaacagttcacaaagcgcaa
gggaatgaatttaaattggtcattatggtcctgacctctcaattcggtcttatgctgaat
aggaacctattgtacacaggaatcacacgagctaaagaagcattaattttggttggtgat
tatcaagctttcaatcgggcagccaaaacaccggtgccacaacgtgcgactactttaaag
cagcgcttacaagcatcaattgtcgacaataaaacctctgaaaaaacaattatcaagcaa
gatgagcccgagaaaaccgttctaacttaccaactgacagctggtattatttcggcgcaa
accattgatccaatgattggtatgaacgaggtcaccccagatgatttcatgttaaattaa

DBGET integrated database retrieval system