KEGG   Leuconostoc citreum: LCK_00724Help
Entry
LCK_00724         CDS       T00663                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lci  Leuconostoc citreum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCK_00724 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCK_00724 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LCK_00724 (thrC)
Enzymes [BR:lci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LCK_00724 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
764755..766215
Genome map
AA seq 486 aa AA seqDB search
MNYISTRGQAPAVTASQAIINGIAPDGGLYVPESWPNIELDWTQLQKQTYADIATLIFDG
FFDDFSVNEIDCVIDKAYGKQWTTEDIVSYHQADDLFYIELFHGPTLAFKDVALQALPHL
MTTAAKKQGLDDGIVILTATSGDTGTAAMSGFGDVQHTDIVVFYPEVGVSDIQRRQMQTE
PAHNAHVTAISGNFDDAQKAVKSLLSDQSLAADLADKHLRFSSANSINIGRLVPQIVYYI
HAYAQLVKQHQIASGEAINIVVPTGNFGNMLAAYYASQIGLPVAQFVVASNENNVLTDFF
NTGTYDRQRTFKVTNAPAMDILVSSNLERLLYFASGRNTEEVREYMNALDEQGHYTLKPS
TQANLSQFKAASASQTEVLKTIKRVFEEGNYVIDPHTAVGQYVYNQLDISGTTILAATAS
PFKFADTVLNALGETPLNEYDGLKQLADKSNVVIPEQIQLLFQRPVIHTQTIAPNQMTTV
LRHQIF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatttctacgcgtggtcaagcaccagcggtgacagctagccaagctataatc
aatggcatagcacctgacggcggactatatgtaccagaaagttggccaaatattgaattg
gattggacgcaactgcaaaaacaaacttatgctgatatcgcaacattaatctttgacggt
ttctttgatgactttagtgttaatgaaatcgattgtgtgatagacaaagcttatggtaaa
cagtggacgactgaggacattgtgtcatatcatcaagccgatgatttgttttatattgaa
ttatttcatggcccaacattagcttttaaagatgttgcattacaggctttgccacatttg
atgacaacggctgccaaaaagcaaggtcttgatgatggcattgtcattttaactgcaact
tctggtgataccggaacagctgctatgagtggttttggagatgtacaacatactgatatt
gttgtattttatccagaggttggtgttagtgacattcaaagacgacaaatgcaaaccgag
ccagcgcacaatgctcacgtaacggctattagtggtaattttgacgatgcgcagaaagct
gttaaatcattattgtcagaccaatcgttagcagccgatttagccgacaagcatttgcga
ttctcttcggcaaattccattaatatcgggcggttagtgccacaaattgtttattatatt
catgcctatgcgcaattagttaaacaacatcaaattgcaagtggtgaggccattaatatc
gttgtacctaccggtaattttggtaatatgttggcggcttactatgctagtcagattggc
ttgcctgttgcacaatttgttgtggcgtcaaatgaaaataatgttttaacagacttcttt
aacactggcacatatgatcgacaacgcacatttaaggtaaccaacgcccctgcaatggac
atcttagtttccagtaacttagagcgtctattatactttgcgtctggtcgtaatactgag
gaagtaagagaatatatgaatgccttagatgaacaagggcattacactttaaagccgtca
acacaggccaacttatcacagtttaaagccgcgagtgcttcacaaacagaagttttgaag
acaattaaacgtgtgtttgaagagggaaattatgtaattgatccacacacagctgttggg
caatatgtttataaccaacttgacatatctgggacaactatcttagctgctactgctagt
ccgtttaaattcgctgatacggtactcaatgcgctaggtgaaacacccctgaatgaatat
gatggcctaaagcaactcgctgacaaaagcaatgttgtcataccggaacaaattcagttg
ctttttcagcgaccagtgattcatacgcaaactatcgcaccaaatcaaatgacaacagtt
ttaaggcatcaaatcttttaa

DBGET integrated database retrieval system