KEGG   Leuconostoc citreum: LCK_00813Help
Entry
LCK_00813         CDS       T00663                                 

Gene name
lacZ1
Definition
Beta-galactosidase/beta-glucuronidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lci  Leuconostoc citreum
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lci00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lci00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
857812..859386
Genome map
AA seq 524 aa AA seqDB search
MTQTLAQILARRDWENLGVIAVNRLSMHAPLQFWHKNEKPVYGQKSNNESVLNGEWQMSY
FDQPEHVPETWLQTDLVTGDKITVPANWQLQGDYDVPIYTNVTYPIPVKPPDVPEQNPTG
AYSKVFNLPEDWLSAGYVHVTFDGVGSAFYLWLNGEFIGYSEDSRLPAEFDLTSAVQLGE
NRLCVLVLRWSKGTYLEDQDMWRLSGIFRDVTLRHLPEQHLLDYCVTTTLDADFDQAIVS
VQTKSTADVFIQAALYWQNTLVATQINSPGTEAIDERGANPNALQLDLIVDKPYLWSDEL
PHLYELVLTVSDKNKVVTHIEHVQVGIRKVAIVNGLLTLNGKPLLIRGVNKHEFHPEKGY
AIDETTMRRDIALLKQNHFNAVRLSHYPNQQRWYELANEYGILLVDEANIETHGMIPMNL
LTDDVNYLPQMLARLTRMVLRDRNFPAIILWSLGNESGYGHNHDALYQWLKQTDTTRPVQ
YEGGGADTIVTDIIAPMYARVSEDQCFPVNTKWSLKRWISKPGE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacattagcgcaaattttagcacgccgcgattgggaaaatctcggcgtgatt
gccgttaatcgcttatcaatgcatgcaccattgcaattttggcataaaaatgaaaagcca
gtgtatgggcagaaaagtaataatgagtcggttttaaatggtgaatggcaaatgagttat
tttgaccagccagaacatgtacccgaaacatggttacaaacagacctagttactggtgac
aaaatcactgttcctgctaattggcagttacagggtgactacgatgttcctatttataca
aatgtaacttatccaattccagtgaagccacctgatgtacccgaacaaaatccaactggg
gcttatagcaaagtatttaatttaccagaagattggttatcagctggttacgtccatgtg
acatttgatggggtgggatctgcgttttacttgtggcttaatggtgagtttattggctac
tctgaagacagccgattacccgcagaatttgatctcacctcagccgtgcagctgggtgaa
aatcgtctttgcgtgctagtattgcgttggagtaaaggcacctatttagaagatcaagat
atgtggcgtttgtctggtatttttcgtgatgtcaccttgagacatctgcccgaacagcat
ttgttagactattgtgtcacaacaacattagatgccgatttcgatcaagccattgtcagt
gttcagacaaagagtaccgccgatgtattcattcaagccgctttatattggcaaaatacg
ttggttgcaacacaaatcaacagtcctggtacagaagcaatcgatgaacgcggcgctaat
ccgaatgcgttgcaattggatttgattgttgacaaaccctatttatggtctgatgaacta
cctcacttatatgaattagtgttaacagtttctgataaaaataaagtagtaacacatatt
gagcacgttcaagttggtatccgcaaggttgctattgtaaatggcctattaactttaaac
ggcaagccattactcattcggggtgttaacaaacatgaatttcacccagaaaaaggttac
gctattgatgaaaccaccatgcggcgggatatcgcgttattaaaacagaaccattttaat
gcagtccgcctatcacattatcccaatcagcagcgttggtatgaattggcaaatgaatac
ggaatacttttggttgatgaggcgaatattgaaacacatggtatgataccgatgaactta
ctgactgacgacgtcaattatctaccacaaatgcttgcccgattgacacgtatggtgttg
cgtgatcgcaattttccggccattattttgtggtcattaggaaatgaatctggctatggt
cataatcacgatgcactatatcagtggttaaaacaaacagatacgactcggccagtacaa
tacgagggcggtggagcggatacaatagtgacagatattatcgcgccaatgtacgctcgt
gtatccgaagaccaatgttttccagttaacaccaaatggtcgttaaaacgctggataagc
aaaccaggtgaataa

DBGET integrated database retrieval system