KEGG   Leuconostoc citreum: LCK_00814Help
Entry
LCK_00814         CDS       T00663                                 

Gene name
lacZ2
Definition
Beta-galactosidase small chain (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lci  Leuconostoc citreum
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LCK_00814 (lacZ2)
  Lipid metabolism
   00600 Sphingolipid metabolism
    LCK_00814 (lacZ2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LCK_00814 (lacZ2)
Enzymes [BR:lci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LCK_00814 (lacZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859420..860844
Genome map
AA seq 474 aa AA seqDB search
MGNSLGGFDRYWQAFRQFERLQGGFIWDWVDQGLAKDGDYAYGGDFGDSPNDRQFSLDGL
LFPDRTAKPALQEVAYQQQYLQFRWLNGQLSVRSEYLFKTTDATLTYTIVVDGKPMKEES
LTLKLPPETKKDIVVCLPKIGQQDVFLNIKVTQNVATIDLPAGHLLAEEQFVLQRKTQFV
SLPVTDRPMVVETSHAVMITSRHNKWYFDTDTGWLTQWLKDGEQQFITPLQDHFTRAPID
NDIGVSEVANPDPNAWEARWHDAGWFNLSAQLDDFAIAKVGAFIEVQTIHHFLAGHEQVL
SSRKTYRFNADGMYLTVEVSRNINSLPPARVGLQVQVGIFDGLSYVGRGPLENYPDRHSG
ARMGYWTQTLDELTTPYIFPSENGLRTAVSSLHWGSHHILAPQTPLQIGASRYSEKALIQ
AKHRTALVADAGVWLNLDGQHMGVGGDDSWSPSVASEYLLTAPFYHYELMWTVN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatagtttagggggttttgataggtattggcaagcctttcgacaatttgagcga
ttgcaaggtgggtttatatgggattgggtcgatcaaggattagcgaaagatggagattat
gcttatggtggcgactttggggattcacctaacgatcgccagttcagtttggatgggtta
ctgtttccagatcgaacggcaaaaccagcgctgcaagaggttgcctatcagcaacaatat
ctgcaatttaggtggctgaatggtcagctaagtgtacgtagtgagtacctatttaaaacg
actgatgcgacattaacgtatactattgttgtagatggtaagcccatgaaagaagaatcg
ttgacgctgaagttgccaccagagacaaaaaaagacattgtcgtttgtttacccaaaatt
ggtcaacaagatgtttttttaaatattaaggtcacacaaaatgtggcgacaattgatttg
ccagctggtcatttattagctgaagaacaatttgttttacagcgcaagacacaatttgta
tccttaccagtgactgataggccaatggttgttgagacttcacacgctgtgatgattacg
agtagacataataaatggtactttgacacagatacgggttggttaactcagtggttaaaa
gatggcgagcaacaatttattacccccttacaagatcattttacacgcgcaccaattgat
aatgatattggcgtgagtgaggtggcaaatccagatcctaacgcttgggaagcgcgttgg
catgatgccggttggtttaatttgtcagcacaattagacgactttgcaatcgcgaaagtc
ggggcatttattgaagtacaaacgatacaccactttttagctggtcatgagcaagttcta
tcctcacgtaagacttaccgcttcaacgcggacggcatgtatttaacagttgaggtgtca
agaaatatcaatagtttaccaccggcacgtgtcggattgcaggttcaagtaggtatattt
gatggcttaagttacgttggtcggggaccccttgaaaactatcctgatagacacagcggc
gcacgcatgggctattggacacaaacacttgacgaattaacgacgccctatatttttccg
agtgagaatggcttgcgtacggcagttagttcattgcattggggcagtcatcatattttg
gcaccccaaacccccttacaaatcggtgcgagtcgctatagcgaaaaagctttgatacaa
gccaaacatcgtacagcgttagttgctgatgcaggtgtttggttaaatttagatggccag
catatgggtgtcggtggggatgattcttggtcgcctagtgttgcgtcagaatacttattg
acagcaccattttatcattatgaactcatgtggacggtaaattag

DBGET integrated database retrieval system