KEGG   Leuconostoc citreum: LCK_00815Help
Entry
LCK_00815         CDS       T00663                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lci  Leuconostoc citreum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCK_00815
   00052 Galactose metabolism
    LCK_00815
Enzymes [BR:lci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LCK_00815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
860857..861897
Genome map
AA seq 346 aa AA seqDB search
MITITDFGQHHGQKVYKYTLQNKNDTRLGVLNFAGILQEFSVATPSGERVNLVLSSDKLE
NLLADYNINRVIGRTAGRIRNGQWVQNGQHITTPSNENGHTLHGGAQGLGEQFFEVTINE
SNNSVTLYRKQTSDDDGFPGTLDVSVTYQLTADDRVITTFTGTQFDTDGVFNPTVHTYFN
LANKEEQTVLGHDLWLNSTQHLAVNHDKVPTGGLIDNADSLFDLKNHSDLGQALHSLQET
TSEGGFDDVFLVRPDLTTPIGYLEDRHSGRRITIYSDRNAAVIFTAGQLDSQVVKNLNRG
DGHPSLAVAIEAQTAPNSENLRVLGDTFLPAGEKRTHTIIYAYTQK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgattacaattactgattttggccaacatcacggtcaaaaagtctacaaatatacatta
cagaataaaaacgacacgcgtttgggtgtgttgaattttgctggcattttacaagaattt
tcagttgccacaccatcaggtgaacgggtcaacttggtgctgtctagtgataaattagaa
aatttacttgctgattataatattaatcgtgtgattggtcgaacggcaggtcgtattaga
aatggccagtgggtacaaaatgggcagcatattacaactccgagtaatgaaaatggtcat
acattgcatggcggtgcgcaaggtttaggtgaacaattctttgaagtaacaattaacgag
tccaataattcggttacactttatcgcaagcagacgtccgatgatgatggttttccaggc
acattagatgtgtcggttacctatcaactaacggccgatgaccgtgtcataacaaccttt
accggaacacaatttgacacggacggtgtctttaatccaacagtgcacacatactttaat
cttgcaaataaagaagagcagaccgttttaggacatgatttgtggctgaatagtacgcaa
catttagcggttaatcatgataaggtaccaactggtggtttgattgacaatgctgactct
ttgtttgatttgaaaaatcattccgatcttggacaggcgctccatagtttacaggaaacg
acaagtgaaggtggatttgatgatgtctttttagtcagaccggatttgacaacacccatt
ggttacctagaagatcgccattctggtagacgaataacaatctattcagatcgcaatgcg
gctgtgatttttacagcgggacaactcgatagtcaggtcgtaaaaaatctgaatcgaggg
gatggccatccatcattagcagttgctattgaagcacaaacggcaccaaatagtgaaaat
ttacgggtattaggtgatacatttttgcccgctggagaaaagcgaacgcacaccattata
tatgcatatacgcaaaaataa

DBGET integrated database retrieval system