KEGG   Leuconostoc citreum: LCK_00935Help
Entry
LCK_00935         CDS       T00663                                 

Gene name
pbg1
Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lci  Leuconostoc citreum
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lci00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(979289..980140)
Genome map
AA seq 283 aa AA seqDB search
MSVDERIEAMSQAAHYELVASAKAVALGHQINPAFKIGGMVNVAPFYPVSPKPADMLAYQ
KARQFRDWLSDVHVRGKYPNELEAYYEKTGYRPDITAEDRDVLQAGTVDYLAVSYYASST
VETTTDEPKVGYTDYEDVANPYIKTSDWGWGLDPEGLRYTLNELSEMYPDTPIMIVENGL
GAYDKIEDGEQIHDDYRISYLSAHIQAMMTAVEIDGVNVIGYLSWGPIDIVSAGTGEMKK
RYGYIYVDLDDEGEGSGNRIKKDSFYWYRKVIETNGQVLKQQA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgatgaacgtattgaagccatgtcacaagcagcacattatgagctagttgct
tcggccaaggctgtggcgcttgggcatcagattaatccagcatttaaaattggtggtatg
gttaacgttgcaccattttatccagtatctcccaaaccagcagatatgttagcttatcaa
aaagcacgtcagtttagagactggctaagtgatgttcatgtccgtggcaagtacccaaac
gaacttgaggcctattacgaaaaaactggatatcgtccagatattacagccgaagaccgt
gacgtgttgcaggcaggaacagttgattatcttgccgtgtcttactatgcaagcagtacg
gttgaaacaacaactgatgagcctaaagtcggttataccgactatgaagatgttgctaat
ccttatattaagacatcagactggggatggggattagaccctgaaggcttgcgctataca
ttaaacgaactaagcgagatgtatccagatacaccaattatgattgttgaaaacggctta
ggtgcctacgataagattgaagatggtgaacaaatccacgatgattatcgaatcagctat
ttatcagcacacattcaagccatgatgacagctgtagaaatcgatggtgtcaatgtaata
ggttatcttagttggggcccaattgatattgtttctgccggcacaggtgaaatgaagaag
cgatacggttatatctacgtcgacctagatgatgagggggaaggatcgggcaatcgtatt
aaaaaggactctttttattggtatcgaaaagtaattgaaacaaacggtcaggtattaaaa
caacaagcatga

DBGET integrated database retrieval system