KEGG   Leuconostoc citreum: LCK_00986Help
Entry
LCK_00986         CDS       T00663                                 

Gene name
glyQ
Definition
glycyl-tRNA synthetase subunit alpha (EC:6.1.1.14)
Orthology
K01878  
glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
lci  Leuconostoc citreum
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lci00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1028081..1029025)
Genome map
AA seq 314 aa AA seqDB search
MTSQKLSLQDIILTLQQYWANQGANLMQAYDNEVGAGTQSPYTFLRANGPEPWHAAYVQP
SRRPADGRYGDNPNRLFQHHQFQVVMKPSPDNIQELYLGSLEALGIKPLEHDIRFVEDNW
ENPSMGAAGIGWEVWLDGMEVTQFTYFQQVGGIEVDSVTAEVTYGLERLASYIQDVPTVY
DLDWGNGVLYGDIFKEPEYEHSKYAFEASDQAMLLRHFDDFEKEATRLLDLGLVHPAYDY
ILKSSHTFNLLDASGSVSVTERAGYLHRIRTMARRVSKVFIDERAKLGFPLLKDDDLREI
YLGEHGKYTLTEEN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcaaaagctatcattacaagatattattttaacgctacagcaatattgggct
aaccagggtgcaaatttgatgcaagcttatgataatgaagtcggtgcgggaacacaatcc
ccctatacatttttgcgcgctaatgggccagaaccatggcatgcagcttatgttcagcct
tcacgtcgaccagctgacggtcgttatggggataatcccaatcgactttttcaacaccat
cagtttcaggttgttatgaagcctagccctgataatatacaagaattatacttgggttct
ttagaggcattaggtattaagccgcttgaacatgacatacgctttgttgaagataattgg
gaaaatccttcaatgggtgcggcaggcattggttgggaagtatggcttgacggtatggaa
gtgacgcagtttacctattttcaacaagttggtggtatcgaagttgactcggttactgct
gaagtaacatatggtttggaaagactagcttcttatattcaagacgtgccaactgtatat
gatttggattggggaaatggtgttttatatggtgatatttttaaagaacctgaatatgaa
cattcaaaatatgcttttgaggcttccgatcaagcgatgttattaagacattttgatgat
tttgaaaaagaagctactcgcttacttgatcttgggcttgttcatccagcctatgattat
attttaaaatcatcgcatacatttaatttgttagatgctagcggcagtgtttctgttact
gaacgagctggttatttgcatcgtattcggacaatggcacgtcgtgtatctaaggtgttt
attgatgagcgcgccaaattaggattcccactacttaaagatgatgatttacgtgaaatc
tatttaggtgagcacggcaagtatacactaacagaggagaattaa

DBGET integrated database retrieval system