KEGG   Leuconostoc citreum: LCK_00986Help
Entry
LCK_00986         CDS       T00663                                 

Gene name
glyQ
Definition
glycyl-tRNA synthetase subunit alpha (EC:6.1.1.14)
Orthology
K01878  
glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
lci  Leuconostoc citreum
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lci00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LCK_00986 (glyQ)
Enzymes [BR:lci01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     LCK_00986 (glyQ)
Amino acid related enzymes [BR:lci01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   LCK_00986 (glyQ)
Transfer RNA biogenesis [BR:lci03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LCK_00986 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1028081..1029025)
Genome map
AA seq 314 aa AA seqDB search
MTSQKLSLQDIILTLQQYWANQGANLMQAYDNEVGAGTQSPYTFLRANGPEPWHAAYVQP
SRRPADGRYGDNPNRLFQHHQFQVVMKPSPDNIQELYLGSLEALGIKPLEHDIRFVEDNW
ENPSMGAAGIGWEVWLDGMEVTQFTYFQQVGGIEVDSVTAEVTYGLERLASYIQDVPTVY
DLDWGNGVLYGDIFKEPEYEHSKYAFEASDQAMLLRHFDDFEKEATRLLDLGLVHPAYDY
ILKSSHTFNLLDASGSVSVTERAGYLHRIRTMARRVSKVFIDERAKLGFPLLKDDDLREI
YLGEHGKYTLTEEN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcaaaagctatcattacaagatattattttaacgctacagcaatattgggct
aaccagggtgcaaatttgatgcaagcttatgataatgaagtcggtgcgggaacacaatcc
ccctatacatttttgcgcgctaatgggccagaaccatggcatgcagcttatgttcagcct
tcacgtcgaccagctgacggtcgttatggggataatcccaatcgactttttcaacaccat
cagtttcaggttgttatgaagcctagccctgataatatacaagaattatacttgggttct
ttagaggcattaggtattaagccgcttgaacatgacatacgctttgttgaagataattgg
gaaaatccttcaatgggtgcggcaggcattggttgggaagtatggcttgacggtatggaa
gtgacgcagtttacctattttcaacaagttggtggtatcgaagttgactcggttactgct
gaagtaacatatggtttggaaagactagcttcttatattcaagacgtgccaactgtatat
gatttggattggggaaatggtgttttatatggtgatatttttaaagaacctgaatatgaa
cattcaaaatatgcttttgaggcttccgatcaagcgatgttattaagacattttgatgat
tttgaaaaagaagctactcgcttacttgatcttgggcttgttcatccagcctatgattat
attttaaaatcatcgcatacatttaatttgttagatgctagcggcagtgtttctgttact
gaacgagctggttatttgcatcgtattcggacaatggcacgtcgtgtatctaaggtgttt
attgatgagcgcgccaaattaggattcccactacttaaagatgatgatttacgtgaaatc
tatttaggtgagcacggcaagtatacactaacagaggagaattaa

DBGET integrated database retrieval system