KEGG   Leuconostoc citreum: LCK_01110Help
Entry
LCK_01110         CDS       T00663                                 

Definition
guanosine polyphosphate pyrophosphohydrolase/synthetase
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
lci  Leuconostoc citreum
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCK_01110
Enzymes [BR:lci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     LCK_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1153495..1155732)
Genome map
AA seq 745 aa AA seqDB search
MAKTKKYSGQEVLDMVSHYMTESDALKVKAAYEWAADLHKAQLRKSGEPYIIHPIQVAGI
LAELRMDTATVISGYLHDVVEDTTATLADVEDKFGTTIAQIIDGVTKISKIQYQNSQEQL
AENHRKLLLAMSKDIRVIIVKLADRLHNMRTLGALREEKRRRIASETLDIYAPLADRLGI
STIKWELEDLSLSYLDPDKYHSIASQMNMKRDERIRYVEEAVREINDAIKDLELDNVSVY
GRPKHIYSIYRKMTDKHKAFEEIYDLSAVRVLTDTIPDTYAVLGAIHSQWMPLPGRFKDY
IALPKANGYQSLHTTVIGPGGRPLEVQIRTHHMHEVAEYGVAAHWAYKKNKGSNKEVKVV
DKNEQTLNVIQGILELQEDAKNAEDFMDGVQGDLFSDRVYAFTPKGDVFELAKGAGPLDM
AFSIHTNVGIKTTGAKVNGRIVPLDYKIKTGDIIEIITSATAKPSRDWLDLVSTRRARNK
IKQYFKQLNRNDNIEAGRELLLRNLRETGFDPNQVMTTDKLTQTAETLHYHAYDDMLAAI
GYGDVAAPGVANKLTEEIREAQQAAQTAELQRELLEEGHEIKRVETALTQRQKASADDIV
IAGVDNLLVRLGRCCTPVPGDPVKGYITKGRGISVHRLGCPNIRAAEIQGQRLVDVQWED
ESGLKPNYDADLTVHGENRNGLLNDVLRSINSRTRYVNSVNGHATKNGMAQVSLSIGVKN
TEQLTAIMDALNNLPAVYDVERTFH
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacaaaaaaatattcaggacaagaagtgttagacatggtgtcgcattacatg
actgaatcagatgcccttaaggtcaaggcggcttatgaatgggctgctgatttacacaag
gcacaattacgtaaatcaggcgaaccttatattattcatccgatacaagttgctggcatt
ttggctgagttacgtatggacacagcaacagttatatcaggatatttacatgatgttgtg
gaagatacaactgcgacgttggccgatgttgaagataagtttgggacgacaattgcacaa
attattgatggcgtaactaagatcagtaaaattcaatatcaaaattcacaagagcaatta
gcagaaaatcatcgtaaattgttgttagccatgtccaaggacattcgtgtaattattgtt
aagcttgctgatcgactgcataacatgagaactttaggagccttacgtgaagaaaagcgt
cgcagaatcgcaagtgaaaccttagacatttacgcaccattagctgatcgattaggtatt
agcacgattaagtgggaacttgaagatttatcattgagttaccttgatcccgataaatat
catagtattgcttcacaaatgaacatgaagcgtgatgagcgtattcgctatgttgaagaa
gctgtgcgtgaaattaatgatgcgattaaagatttagaattagataatgtcagtgtttat
ggtcgaccaaagcatatttattcaatttatcgaaaaatgaccgataaacataaagccttt
gaagaaatttatgacttatcggctgtgcgcgtattgactgatactattccagatacttat
gcggtgttaggggctatccattcccaatggatgcctttgcctggccgattcaaagattat
attgctttgccaaaagccaatggttatcaaagtttgcacacgacagttattggccctggt
ggtcgacctttggaagttcagattagaacgcatcatatgcatgaagtcgctgaatatggt
gtggctgcgcattgggcctacaagaaaaataagggttcaaataaagaagttaaagtcgtt
gataaaaatgaacaaacgcttaatgtcattcaaggtattttggaattacaagaggacgct
aaaaatgcggaagatttcatggacggtgtacaaggggacttgttcagtgaccgcgtttat
gcttttacccccaaaggggatgtctttgaattagctaaaggtgcaggaccgcttgatatg
gctttttccattcacacgaatgttgggattaaaaccactggtgcgaaagttaatggtcgg
attgtgccactagattataaaattaaaactggtgatattatcgaaattattaccagtgca
acagccaaaccaagccgtgattggttagatttagtttcaactcggcgcgctcgtaataaa
attaagcaatatttcaagcaactaaaccgtaacgacaatatcgaggctgggcgagagctg
cttttgcggaacttaagagaaaccggtttcgaccctaatcaggtcatgaccactgataaa
ctcacgcagacagcagaaacattacattaccatgcgtatgacgatatgttagcagcgatt
ggctacggagatgtagcggcaccaggtgtagctaataagttgactgaagagattcgtgag
gcacagcaagcagcccaaacggcagaattacagcgtgaattacttgaagaagggcacgag
attaagcgtgttgagacagcattaacacagcgacaaaaagcttcagctgatgatattgtg
attgctggtgttgataatttattggttcgtttaggtcgctgctgtacaccagtcccaggt
gaccctgtcaaaggctatatcactaaaggacgcggtatttcagtgcatcgtctggggtgt
cctaatattcgtgcagcagaaatacaaggccaacgcttagttgatgtgcaatgggaagat
gaatcaggccttaagcctaattatgacgctgatttgacggttcatggtgaaaaccgaaat
ggtttgttgaacgatgtcttacgatccattaatagccggacacgttatgttaattcagtt
aatggtcatgcgactaagaatggtatggcgcaagtgtcactatccatcggtgttaaaaat
acagagcagttaacagcgattatggatgcgttaaataacctacccgctgtttatgatgtt
gagcggacgtttcattga

DBGET integrated database retrieval system