KEGG   Leuconostoc citreum: LCK_01144Help
Entry
LCK_01144         CDS       T00663                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lci  Leuconostoc citreum
Pathway
lci00010  Glycolysis / Gluconeogenesis
lci00052  Galactose metabolism
lci00500  Starch and sucrose metabolism
lci00520  Amino sugar and nucleotide sugar metabolism
lci00521  Streptomycin biosynthesis
lci01100  Metabolic pathways
lci01110  Biosynthesis of secondary metabolites
lci01120  Microbial metabolism in diverse environments
lci01130  Biosynthesis of antibiotics
lci01200  Carbon metabolism
Module
lci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCK_01144 (glk)
   00052 Galactose metabolism
    LCK_01144 (glk)
   00500 Starch and sucrose metabolism
    LCK_01144 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LCK_01144 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCK_01144 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LCK_01144 (glk)
Enzymes [BR:lci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LCK_01144 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACA82971
UniProt: B1MZL9
Position
complement(1189291..1190250)
Genome map
AA seq 319 aa AA seqDB search
MAKDKLIGVDLGGTTIKFAILTDAGEIQQKWSIKTNTFDEGSHIVPDIIESINHHLDLYQ
LDPERIIGIGMGTPGTVNRETGTVTGAFNLNWKTEQPVKANIETGTGFKLTLDNDANAAA
LGEAWKGAGNNDDEVSFITLGTGVGGGLVSNGQLIHGTAGAGGEVGHVVVEPNGYLCTCG
NHGCLEQYASATGVVRLAQDSAEEYVGSSKLKQMISDGDEVTSKIVFDLAKDGDFLANEV
VNKVAYYLGYATAAISNILNPSAIIIGGGVAAAGEFLRARIEKEWTKFAFPTVRVSTRVK
LAELGNDAGVIGAASLARV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagataagctcattggtgttgatttaggtggtacaacaattaagtttgctatt
ttgactgatgcaggggaaatacaacaaaagtggtcaatcaagactaatacttttgatgaa
ggttcacatattgtacctgatatcatcgaatcaattaatcatcatcttgatttgtatcaa
ttagatccagaacgaatcattggtattggcatgggaacgcctgggacagttaatcgcgag
acaggaactgtgacgggtgcgttcaatttaaattggaaaacagaacaaccagtaaaagct
aatatcgagacaggcacaggtttcaagttaacattagacaacgatgcgaatgcagcagcg
ctcggtgaagcttggaagggtgctggcaataatgatgatgaagtatcgttcatcacatta
gggacaggcgttggtggcggtctggtatcaaatggccagttaatccatggcacggccggt
gctggtggtgaagttgggcatgttgttgttgaacccaatggttacttgtgcacttgcggg
aatcatggttgtctagaacaatatgcttcagcaacgggtgttgtacgcttggcacaagat
tctgctgaagaatatgtcggttcgtctaagctcaaacaaatgatttcagacggtgatgaa
gtgacttcaaaaattgtctttgacttagcaaaagatggtgattttttggctaatgaagtt
gtaaataaggtagcttattatcttggttatgctactgcggcaatttcaaatattttaaat
ccttctgctattattattggcggtggtgttgctgctgcgggcgaatttttgcgtgcacga
attgaaaaagaatggacaaagtttgcctttccaactgttcgtgtatcaacgcgtgtgaag
ttagctgaattaggtaatgatgctggtgtaattggcgcggcatcattagcgcgtgtataa

DBGET integrated database retrieval system