KEGG   Leuconostoc citreum: LCK_01248Help
Entry
LCK_01248         CDS       T00663                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lci  Leuconostoc citreum
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lci00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1302414..1303865)
Genome map
AA seq 483 aa AA seqDB search
MKKLTNEAMLITYADSLGKNLKELNQVLSNELDGVVGGVHVLPFFPSTGDRGFAPEEYET
VDPKFGDWSDIDKLAEKYYLMFDFMLNHISPQSKYFQDFLEKKEASEYYDMFLKYSEFWP
ENRPTEADIDLIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQMDLDVTKEVTKKFIKDSL
VNLAHHGASVIRLDAFAYAIKKLDTNDFFVEPEIWNILDEVREILAAEGSEVLPEIHEHY
KIVRKITEHDMYSYDFALPLITLYSLYSGKTNRLADWLRQSPMKQFTTLDTHDGIGVVDA
KDLLTQEETDFTTEEMYKVGANVKKIFSSAAYNNLDIYQINTTYYSALGNDDAAYLLARA
AQIFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDLAEIAETTKRPVVSNLFNL
LRFRNTSSAFDLDGTIDVINDGENELTITRTSADGKTTAVLDANFETKQFTVTENGVEIF
ATK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcttaccaatgaagcaatgctaattacatatgctgactcacttggaaagaat
ttaaaagaattaaatcaagttttgtcaaatgaacttgatggtgttgttggtggtgtccac
gtgttgccatttttcccttcaacaggtgatcgcggattcgcccctgaagaatacgaaaca
gtcgacccaaagtttggtgactggtcagatatcgataagttagcagaaaaatattacttg
atgtttgatttcatgttgaatcatatttcaccacaatcaaagtatttccaagacttctta
gaaaagaaagaagcatcagaatattatgacatgttcttgaagtattctgaattttggcct
gaaaaccgtcctactgaagctgatattgatttgatttacaagcgtaaggataaggcacca
tttgcacccgtaacgtttgctgatggtacaaccgatcaagtatggaacactttcggtgac
caacaaatggatttggatgtcactaaagaagtaactaaaaagttcatcaaagactcattg
gttaatttggcacatcatggtgcatctgttattcgtttagatgcctttgcttatgcgatt
aaaaagttggacacaaatgatttcttcgttgaaccggaaatttggaacatcttagatgaa
gttcgtgaaatcctggcagcggaaggatcagaagtgttgccagaaatccatgaacactac
aagattgtccgtaagattactgagcatgacatgtattcatatgactttgctttgccatta
atcacgttgtattcattgtactcaggaaagacaaatcgtttagctgattggttacgtcaa
agcccaatgaagcagtttacaacattggatacacacgatggtattggtgttgttgatgct
aaggacttgttgacacaagaagaaactgactttacaactgaagaaatgtacaaagttggt
gccaacgttaagaagattttctcatcagcagcttataacaacttagacatttaccaaatt
aacacgacttattactcagcattaggaaacgatgacgctgcttacttgctagcacgtgca
gctcaaatttttgcaccaggtattccacaaatttattatgttggtttgcttgcgggtgaa
aatgatattgagttactagaaagctcaaaagaaggccgtaacattaaccgtcattattat
gatttggctgaaattgctgaaacaacaaagcgtccggttgtttcaaacttgtttaacttg
ctacgtttccgtaacacaagctcagcgtttgatttagatggtacaatcgatgtgatcaat
gatggtgaaaacgaattaacaatcacacgtacgtctgcagatggtaagacaacagctgtg
ttggatgctaattttgaaacaaaacaatttactgtaacagaaaatggtgttgaaattttc
gctacaaagtaa

DBGET integrated database retrieval system