KEGG   Leuconostoc citreum: LCK_01251Help
Entry
LCK_01251         CDS       T00663                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lci  Leuconostoc citreum
Pathway
lci00040  Pentose and glucuronate interconversions
lci00052  Galactose metabolism
lci00500  Starch and sucrose metabolism
lci00520  Amino sugar and nucleotide sugar metabolism
lci01100  Metabolic pathways
lci01130  Biosynthesis of antibiotics
Module
lci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LCK_01251 (galU)
   00052 Galactose metabolism
    LCK_01251 (galU)
   00500 Starch and sucrose metabolism
    LCK_01251 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LCK_01251 (galU)
Enzymes [BR:lci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LCK_01251 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACA83076
UniProt: B1MZX4
Position
complement(1306480..1307352)
Genome map
AA seq 290 aa AA seqDB search
MKPVRKAVIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREAIASGIEDIVIVDGKS
KRSIEDHFDSNPELENNLREKGKDELLKIVQETTDINMYFIRQSHPNGLGDAVLTAKAFI
GDEPFVVLLGDDLMQDEVPLTKQLIERYEETGESTLAVMKVPHDQVSEYGVIDPAAEASD
GLYRVKTFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTKPGKGNEIQLTDAIDSLNNR
QHVYAHEFKGSRYDIGSKIGFLETNIEFGLKHPQTRDQLRAYIKELAAKL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtacgtaaagcagttattccagccgcaggattaggcacacgtttcctgcca
gcaacaaaggcacttgccaaagagatgctcccaattgttgatacgccaacaattgaatat
attgtgcgtgaagccatcgcctcaggaattgaagatattgtgattgttgatggtaagtca
aagcgctcaattgaagatcattttgattctaatcctgaactagagaataatctgcgtgaa
aaaggcaaagatgaactattaaagattgttcaagaaactaccgatattaacatgtatttt
attcgtcagtcacatccgaatgggttaggcgatgctgttttgactgcaaaagcttttatc
ggcgacgagccatttgtcgtgttactaggtgatgacttaatgcaggatgaagtaccactc
acaaagcaactaatagaacgttatgaagaaactggcgaatcaacgctagcggttatgaag
gtaccacatgatcaagtttctgagtacggggtaattgatccagctgctgaagcttctgat
ggtttataccgtgttaagacatttgtggagaagcctaagccagaagatgcaccatctgat
ttggcgattattggtcgctacttgttgacaccagaaatttttgaagaattagaaaatacg
aaacctggtaaaggtaatgaaatccaattgactgatgcaattgattctttgaacaatcgt
caacacgtttatgcacatgaatttaaaggtagccgatatgacatcggatctaagattggt
ttcttagaaactaatattgaatttggtttgaagcatccacagacacgtgatcagttgcgt
gcttatattaaggaattagctgcaaaattataa

DBGET integrated database retrieval system