KEGG   Leuconostoc citreum: LCK_01394Help
Entry
LCK_01394         CDS       T00663                                 

Definition
dextransucrase
Orthology
K00689  
dextransucrase [EC:2.4.1.5]
Organism
lci  Leuconostoc citreum
Pathway
Starch and sucrose metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LCK_01394
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LCK_01394
Enzymes [BR:lci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.5  dextransucrase
     LCK_01394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1463600..1468087)
Genome map
AA seq 1495 aa AA seqDB search
MQNGEVCQRKKLYKSGKILVTASIFAVMGFGTAISQANASSSDNDSKTQTISKIVKSKVE
PATVQPAEPTNKIVDQADMHTVSGQNSVPPVVTNQSNQQAAKPTTPVTDVTDTHKIEANN
VPADVMPANAPDKQSVTNAPVVPPKHDTDQQDDSLEKQQVLEPTVNSNIPKKQTNQQLAV
VTAPANSAPQTKTTAEISAGTELDTMPNVKHVDGKVYFYGDDGQPKKNFTTIIDGKPYYF
DKDTGALSNNDKQYVSELFSIGNKHNAVYNTSSDNFTQLEGHLTASSWYRPKDILKNGKR
WVPSTVTDFRPLLMAWWPDKSTQVTYLNYMKDQGLLSGTHHFSDNENMRTLTAAAMQAQV
NIEKKIGQLGNTDWLKTAMTQYIDAQPNWNIDSEAKGDDHLQGGALLYTNSDMSPKANSD
YRKLSRTPKNQKGQIADKYKQGGFELLLANDVDNSNPVVQAEQLNWLHYMMNIGSILQND
DQANFDGYRVDAVDNVDADLLQIAGEYAKAAYGVDKNDARANQHLSILEDWGDEDPDYVK
AHGNQQITMDFPLHLAIKYALNMPNDKRSGLEPTREHSLVKRITDDKENVAQPNYSFIRA
HDSEVQTIIADIIKDKINPVSTGLDSTVTLDQIKQAFDIYNADELKADKVYTPYNIPASY
ALLLTNKDTIPRVYYGDMFTDDGQYMAKQSPYYQAIDALLKARIKYAAGGQTMKMNYFPD
EQSVMTSVRYGKGAMTASDSGNQETRYQGIGLVVNNRPDLKLSDKDEVKMDMGAAHKNQD
YRPVLLTTKSGLKVYSTDANAPVVRTDANGQLTFKADMVYGVNDPQVSGYIAAWVPVGAS
ENQDARTKSETTQSTDGSVYHSNAALDSQVIYEGFSNFQDFPTTPDEFTNIKIAQNVNLF
KDWGITSFEMAPQYRASSDKSFLDAIVQNGYAFTDRYDIGYNTPTKYGTADNLLDALRAL
HGQGIQAINDWVPDQIYNLPDEQLVTAIRTDGSGDHTYGSVIDHTLYASKTVGGGIYQQQ
YGGAFLDQLKTQYPQLFQQKQISTDQPMNPDIQIKSWEAKYFNGSNIQGRGAWYVLKDWG
TQQYFNVSDAQTFLPKQLLGEKAKTGFVTRGKETSFYSTSGYQAKSAFICDNGNWYYFDD
KGKMVVGNQVINGINYYFLPNGIELQDAYLVHDGMYYYYNNIGKQLHNTYFQDKQKNFHY
FFEDGHMAQGIVTIIQSDGTPVTQYFDENGKQQKGVAVKGSDGHLHYFDGASGNMLFKSW
GRLADGSWLYVDEKGNAVTGKQTINNQTVYFNDDGRQIKNNFKELADGSWIYLNNKGVAV
TGEQIINGQTLYFGNDGRQFKGTTHINATGESRYYDPDSGNMITDRFERVGDNQWAYFGY
DGVAVTGDRIIKGQKLYFNQNGIQMKGHLRLENGIMRYYDADTGELVRNRFVLLSDGSWV
DFGQDGVPVTGVQVINGQTLYFDADGRQVKGQQRVIGNQRYWMDKDNGEMKKITY
NT seq 4488 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacggcgaagtgtgtcagcgtaaaaaactgtacaagtcagggaagatattagtt
acagcaagtatttttgctgttatgggttttggtactgccatatcacaagcaaacgcgagc
agtagtgataatgatagcaaaacacaaactatttcaaaaatagtaaaaagtaaagtcgaa
ccggcaactgttcaaccagcggaacctactaataaaatagttgaccaagcagatatgcat
acggtcagcgggcaaaacagcgtgccaccagtagtgactaatcaatccaatcaacaggct
gcaaaaccaactacacctgttaccgatgtcacagatacgcataaaatcgaagcaaacaac
gtccctgctgatgttatgccagcaaatgccccagataaacaatcagtgactaatgcacca
gtagtgccgccaaagcatgatacggaccagcaggacgattcactagaaaaacagcaagta
ttagaaccgaccgtaaatagtaatataccaaaaaagcagacaaatcaacagttagcggtt
gttacagcaccagcaaattcagcacctcaaaccaaaacaacagcagaaatttctgctggt
acagagttagacacgatgcctaatgttaagcatgtagatggcaaagtttatttttatgga
gatgatgggcaaccaaaaaagaattttactactattatagatggtaaaccttactacttt
gataaagatacaggggcactatctaataacgataagcaatatgtatcggaattattcagt
attggcaataaacataacgccgtctataacacatcatcagataattttacgcaattagaa
ggacatctgacggcaagtagttggtatcgtccaaaagatattttgaaaaatggtaaacgt
tgggtaccttcaacagtgactgatttcagaccattattgatggcctggtggccggataag
agtacgcaagtcacttatctgaattacatgaaagatcagggcctcttgtctggtactcat
cacttttccgataatgaaaatatgcggaccttaacggcagctgccatgcaggcacaggta
aacattgagaaaaaaattgggcaacttggcaatacggattggttgaaaacggcgatgacg
caatacattgatgcccagcccaattggaatattgacagtgaggcgaaaggagatgatcat
ctacaaggtggtgcactgctttatacaaatagtgatatgtcgccaaaggccaattctgat
tatcgtaagctgagccgtacgcctaaaaatcaaaagggtcaaattgctgataaatataag
caaggtgggtttgaattattactagcaaacgatgtcgataattctaatccagttgtgcaa
gcagaacaacttaattggttacattatatgatgaatatcggtagtattttacaaaatgat
gatcaagctaattttgatggttaccgtgttgatgctgtcgataatgtggacgctgactta
ctacagattgctggtgaatatgctaaggctgcctatggtgttgacaaaaatgacgcgaga
gcgaatcaacatctatcaattttggaagactggggagatgaagatccagactatgtcaaa
gcacatggcaaccagcaaattacaatggatttccccttgcatttagcgattaaatacgcg
ctcaacatgcctaatgataaacggagtggccttgagccaacccgtgaacacagtttagtc
aaacgaattacagatgataaagaaaatgttgcacaaccaaattattcatttatccgagct
catgacagtgaagtacaaacgattattgctgatattattaaagataaaatcaacccggtc
tcaacagggttagattcaacagtgactttggatcaaattaagcaggcttttgacatctat
aatgctgatgaattgaaagcagataaagtttacacaccttacaatattccagcttcatac
gctttgttattaactaataaagacacaattccacgtgtttattatggtgatatgttcacg
gatgatggccaatacatggctaaacaatcaccttactatcaagccattgatgcgttgttg
aaagctcgtatcaagtatgctgctggtggtcaaaccatgaaaatgaactattttccagat
gaacaatctgttatgacatcagttcgttatggtaagggtgcaatgacggcaagtgactct
ggtaaccaagagacacgctatcaaggtattggacttgttgtcaacaatcgcccagatttg
aaactatctgacaaagatgaagtcaaaatggatatgggtgcggcacataaaaaccaagat
tatcgcccagttttgttgacgacaaaatcaggattaaaagtctacagcactgatgcaaat
gcacctgtcgttcgaactgacgccaatggccaattaacttttaaggcagacatggtatat
ggtgtaaacgacccacaagtgtcagggtacattgcggcttgggtaccagtaggggcttca
gaaaatcaagatgctcgaacgaaaagtgaaacaacgcagtcaactgacgggagtgtttat
cattctaatgcagcgttagattcgcaagtcatttatgaaggcttttcaaattttcaagac
tttccaacaacacccgatgagtttacgaacattaaaattgctcaaaatgttaacttattt
aaggattggggtattactagctttgaaatggcaccacaatatcgcgccagctcagataaa
agtttcttagatgctatcgtacaaaatggttatgcatttacagatcgatatgatattggt
tacaacacaccaacaaagtatgggacagcagataatttgttagatgctttacgtgcattg
catggtcaggggattcaagcgattaacgactgggtaccagatcaaatttataatctaccc
gatgaacagttagtcacggctattcgaacagacggttcaggtgatcatacttatggttca
gttattgaccatactttgtatgcatcaaaaacagttggcgggggcatttatcagcaacaa
tatggtggggccttcttggatcaattaaaaacacagtacccgcaacttttccagcaaaaa
cagatttccacagatcagccaatgaacccagatattcaaattaagtcatgggaagccaag
tacttcaacggttcgaacattcaggggcgtggggcttggtatgttttgaaggactggggc
acacaacagtattttaatgtgtcagatgcgcagaccttccttccaaagcaattattgggt
gaaaaggccaaaactggttttgttacgcgtggtaaggagacttcattctattccactagt
ggctatcaagcaaaatctgcctttatttgtgataatggtaattggtactactttgatgac
aaagggaaaatggttgttggaaaccaagttatcaatggcatcaattattactttttaccg
aatggtatcgaattacaagatgcctatctagtacatgatggtatgtactattattataat
aatattggcaagcaactgcacaacacatattttcaagataaacaaaaaaatttccattac
ttctttgaagatgggcacatggcacagggtattgtcaccatcattcaaagtgatggcacc
ccagtcacacagtactttgatgaaaatggtaagcaacaaaaaggcgtggcggtcaaagga
tcagatggtcatttacattactttgacggtgcgtcagggaatatgctctttaaatcatgg
ggtagactagcagatggctcttggctatatgtagacgagaaaggtaatgcggttacaggc
aaacaaaccattaataatcaaacggtttactttaatgatgatggtcgtcaaatcaaaaat
aactttaaagaattagcagatggttcttggatttatcttaacaataaaggtgttgcagta
acaggagagcaaataattaatgggcagacactttattttggtaacgatggtcgtcaattt
aaagggacaacacatataaatgctactggtgaaagccgttactatgacccagactcaggt
aatatgataactgatcgttttgaacgtgttggtgataatcaatgggcttattttggttat
gatggtgttgcagtaacaggggaccgaatcattaaagggcaaaaactctatttcaaccaa
aatggtatccaaatgaaaggccacttacgtcttgaaaatggtatcatgcgttattacgac
gctgatactggcgaattagttcgtaatcgatttgtattgctatctgatggttcatgggtt
gactttggccaagatggcgtacccgtaactggcgtgcaagtgattaatggccaaacatta
tattttgacgcagatggtaggcaagtcaaagggcagcaacgtgtaatcggcaatcaacgc
tattggatggataaagacaatggtgaaatgaaaaaaataacatactag

DBGET integrated database retrieval system