KEGG   Leuconostoc citreum: LCK_01400Help
Entry
LCK_01400         CDS       T00663                                 

Gene name
tpiS
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lci  Leuconostoc citreum
Pathway
lci00010  Glycolysis / Gluconeogenesis
lci00051  Fructose and mannose metabolism
lci00562  Inositol phosphate metabolism
lci01100  Metabolic pathways
lci01110  Biosynthesis of secondary metabolites
lci01120  Microbial metabolism in diverse environments
lci01130  Biosynthesis of antibiotics
lci01200  Carbon metabolism
lci01230  Biosynthesis of amino acids
Module
lci_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCK_01400 (tpiS)
   00051 Fructose and mannose metabolism
    LCK_01400 (tpiS)
   00562 Inositol phosphate metabolism
    LCK_01400 (tpiS)
Enzymes [BR:lci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCK_01400 (tpiS)
Exosome [BR:lci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCK_01400 (tpiS)
  Exosomal proteins of bladder cancer cells
   LCK_01400 (tpiS)
  Exosomal proteins of melanoma cells
   LCK_01400 (tpiS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PgaPase_1
Motif
Other DBs
NCBI-ProteinID: ACA83224
UniProt: B1N0C2
Position
complement(1473953..1474660)
Genome map
AA seq 235 aa AA seqDB search
MICIVNFKSLMCYKKQLQWLQDIEQLPLNFKLLVAPTLPEHNTYQNYEIIAQNISLAQRT
VGEMSANVLKALDIRYAFVGHLERRKLLNETTDIIHERLANCLNNDMIPIICLGMHSGPD
LVIRELKSILKNIDFMGQRIIVAYESLRSTQSNSSAYSYVEMEAVYLKLNQYLSELVKNS
NLASYSLVMGGHITAEGISVARKIGYDGVLIGDRYQEVSAFQPIIEALNQVKKER
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtatcgttaattttaagagtctgatgtgctataagaaacagctacaatggtta
caagatattgagcaactgccacttaattttaagttactggttgcaccaacactacctgag
cacaacacgtatcaaaattatgaaattattgcgcaaaacattagtctagcacaacgtacc
gttggtgaaatgtctgccaatgtgcttaaagcattagacattagatacgcttttgttggt
catttagaacgacgaaaattattgaacgagaccacggatatcatccatgaacgtttagcc
aactgtctgaataatgatatgattccaattatttgtttggggatgcatagtggcccagat
ttggttatacgtgaattaaaatctattcttaaaaatattgattttatggggcaacgtatt
attgttgcttatgaatcgcttcgttccacacagtctaatagttcagcgtactcttatgta
gaaatggaagctgtttatttgaagttaaatcaatatctgtctgaattagtgaaaaacagc
aatttagcgtcttatagtttagtaatgggtggacatattacggcagaaggtatttctgta
gctcgaaagattggctatgatggggtgcttattggcgatcggtatcaagaagttagtgca
tttcagcccattattgaggcattaaatcaagttaaaaaagaaaggtga

DBGET integrated database retrieval system