KEGG   Leuconostoc citreum: LCK_01469Help
Entry
LCK_01469         CDS       T00663                                 

Gene name
murC2
Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lci  Leuconostoc citreum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lci00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lci00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1548353..1549711
Genome map
AA seq 452 aa AA seqDB search
MTLKSTLARTTAKSAHWLLHDVLHRGGTSLPGKLAVSIDPDVLKSIQQDFDLVIVTGTNG
KTLTTALITRVLQAGGYEVITNHSGSNMIQGITGTLVTSKIKPSANGKKPVAVLEVDEAN
VEKIASAIKPKMFVLTNIFRDQLDRYGEIYTTYDKIIAGIKHAPEAVVLANGDSPIFTRG
DFPNERRYFGFNHVQPAEYQPGAAPINTDGILSPTDHSVLHYDFITYANLGKYFSTTDQF
ARPNLRYQVTHVDELTPKYSTFSIDNTPLRIEIGGLYNIYNALTAFAVGREFNVSADQIK
TAFESNAQIFGRQEAIHVDGKDVTIVLIKNPVGTNSVIDMMLTEQDDFSMLALLNANYAD
GIDTSWIWDAEFEKLHDTNIQAVATGGQRYKDIHVRLKMAGFEDQAIYQDLTRIVEAIKA
MPTDKVYIVATYTAMLQLREQLGSAGYIKGGF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgacacttaaaagtacacttgcacgtacaacagccaaaagcgctcattggttgctacat
gacgtgctccatcgtggtggcactagcttaccaggtaaattagctgtatctattgatcct
gatgttttaaagtctattcagcaagattttgatttagttattgttaccggtacaaatggt
aaaacgttaaccactgccttaatcacacgtgttttacaagctggcggttatgaagtcatt
accaaccattctggctcgaatatgattcaaggtatcactggtacgctagttactagtaaa
attaagccatcagcgaatggcaagaagcccgttgctgtattagaagtagatgaagctaac
gtcgaaaaaattgcttctgcaattaagcctaagatgtttgttttgacaaatatttttcga
gatcaacttgaccgctatggtgaaatttacaccacttacgataaaattatcgcgggtatc
aagcatgcccccgaagcggtcgtcttagctaatggcgattcaccaattttcacacgcggc
gatttcccgaatgaacgacgttattttggatttaatcatgtacagcctgcagaatatcag
ccaggtgcagcaccaattaatacagacggtattttatcaccaacagaccacagtgtattg
cactatgatttcattacttatgctaatcttggtaaatattttagcaccactgatcaattt
gctaggcctaacttacgctatcaagtcacacatgtcgatgagctcacaccaaaatactct
actttttcaattgataatacaccactgcgcattgagattggtggtttgtacaacatttat
aacgccctcaccgcctttgctgtcggacgcgaatttaatgtttcagccgatcagataaaa
acagcttttgagtcaaatgcacaaatatttggtcgccaagaagccattcatgttgatggt
aaggatgtcaccattgtcctcattaaaaacccagtcggcaccaattcggttattgatatg
atgcttaccgaacaggatgatttttctatgctcgcattactcaatgccaattatgccgat
ggtattgacacaagctggatttgggatgctgagtttgaaaaactgcatgataccaacatt
caagctgttgccaccggtggtcagcgttataaagatattcacgttcgtttgaaaatggcc
ggctttgaagatcaggccatttatcaagatcttacacgtattgttgaagcaatcaaagcc
atgccaacagataaggtatacattgtcgcaacttacacggcaatgctacaattacgtgaa
caattaggctcggctggctacattaaaggaggcttttaa

DBGET integrated database retrieval system