KEGG   Leuconostoc citreum: LCK_01703Help
Entry
LCK_01703         CDS       T00663                                 

Gene name
fadA
Definition
(GenBank) Acetyl coenzyme A acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lci  Leuconostoc citreum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCK_01703 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    LCK_01703 (fadA)
   00640 Propanoate metabolism
    LCK_01703 (fadA)
   00650 Butanoate metabolism
    LCK_01703 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    LCK_01703 (fadA)
   00072 Synthesis and degradation of ketone bodies
    LCK_01703 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCK_01703 (fadA)
   00310 Lysine degradation
    LCK_01703 (fadA)
   00380 Tryptophan metabolism
    LCK_01703 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCK_01703 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCK_01703 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LCK_01703 (fadA)
Enzymes [BR:lci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCK_01703 (fadA)
Exosome [BR:lci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCK_01703 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1786800..1787951)
Genome map
AA seq 383 aa AA seqDB search
MNNLTTPVGILSAKRLPIGKINGLYTEQSPETLVANLLQQQVAMISTHRLKQVDQVILGN
VTNQGGNIARRAALAAGIDSSTPAYTIDAQCASGLVAIASGAQAILNQDAKLVVAGGVES
TSRSYVTIDRETNEPLKRFPMVPEGQLDLDMGIVAENMSSRYNISREQQDNYAFNSHQKA
KKAFENKQINAEIVPFSQASVNITQDQCPRFDTSLSKLHQLKPAFRSGGTVTAGNSCPIN
DGAATVLMTGSQTGEAMAGYYLGHTTVGIAPEKFILGPIAATQKLLDKYALTMSDIAVVE
LNEAFAVQSILCQAALKITDEQLNPLGGALAYGHPYGATGGIMIARLLNSLNRITQPALG
IATLCVAGGMGMSMLIGNQHWQV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaataacttgacaacaccagtaggcatattaagcgcaaaacgtctcccaattggtaaa
atcaatggcttatacacagagcagtcgcctgagacacttgttgctaatttgttacaacag
caggtagccatgatatcaacacatcgtttaaagcaggttgatcaagtcattttaggcaat
gtcacgaatcaagggggaaatattgcgcgtcgtgcagctttagccgctgggatagattcg
agcacaccagcttatactatagatgcgcaatgtgcttctggtttggtggctattgcttcc
ggcgcccaagccatcttgaatcaggatgccaaattagtcgttgcgggtggcgtcgaaagt
acttcccgtagttatgtgacaattgatcgagaaacaaatgagccactcaaacgctttccg
atggtaccagaagggcaactggacttagacatgggtattgtggcggaaaatatgagctca
cgttataacatttcacgcgagcaacaggataattacgcgttcaacagccatcaaaaagca
aaaaaagcttttgaaaataagcaaatcaatgctgaaattgttccttttagtcaggcgtca
gtcaatatcacacaagaccagtgtccgagatttgatacctcgcttagtaaattacaccaa
ttgaagccagcgtttcgttctggtggtacggtgactgcgggcaatagttgtccgattaat
gatggtgcggcaacggtgctgatgacgggaagtcaaacaggggaagcaatggcggggtat
tatttagggcatacgaccgtaggcattgcgcctgaaaaattcattctgggtcctattgct
gccacacaaaagttattagacaaatatgcactaactatgtctgacattgcagttgtggag
cttaatgaggcttttgccgtgcaaagtattttatgccaagcggcgttaaaaattaccgat
gaacaattaaatccattaggtggcgcgttagcttatggtcatccctatggtgctacgggt
ggcattatgattgcgcgattattgaatagtttaaatcgcatcacacaaccggcgttgggt
attgccacgctatgtgttgccggtggtatggggatgagcatgctgataggaaatcaacac
tggcaagtttaa

DBGET integrated database retrieval system