KEGG   Latimeria chalumnae (coelacanth): 102345198Help
Entry
102345198         CDS       T02913                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     102345198 (EEF2K)
Protein kinases [BR:lcm01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   102345198 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 753 aa AA seqDB search
MADEDMIFSMEGVDTTRAKKGGSGDSPDSDDEENYFICSITEDPRTVKTAAQNTPSNYLK
NHLRSEEQYGVSSSPKPSFKNEMQPPVKLGSLHDQGRETWRLAVQKAKQMPDPWAEFHLE
EIETESAIRYRYSAITGEWAEDEVLIKMAKQPFGRGAMRECYRTKKLSNFSHSQHWKSAF
NYVAKRYIETVDRDVYFEDVKLQMEAKLWGEEYNRHKPPKQVDIVQMCILEMKDRPGNPL
FHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDP
QIHTESGDSFGDGNLGVRGMALFFHSHSCNRICKSMRLTPFDLSSKEKAALDHTNKLLQS
AQTVLRGTEEKCGSDRVRTISGSRPPLLFRLSENSGDENMSDNAFDSLPCSPSTPIQQSP
LGWPELNEDRFQGQDDNNNLENHRDSESGGDSGYPSERRSELEEMEPRDRASSNSRRRYD
SDDDSFSRRKAVVSKLSLTPKNSLRKKMLTTENWNFFNSSRTHIHRPSCVAVEMQRLDAL
ELEKKIGKSILGKVHLAMVRYHEAGRFCEKDEEWDWESALYHLEHAALCGELEAIVGLGL
MHSQLPHHILSDVNSEDTKENKIKGFNYLLKGADAGDRPSMILVARAYDTGNNLGPDRKQ
DWVEAVHWYDMVLNMTDYDEGGEYDGTQDEPQYLLLAREAEMFLTGGFGLEKDPLRSGDL
FTEAADAAMEAMKGRLANQYYEKAEEAWAMMED
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagatatgatttttagcatggaaggggttgataccaccagggcaaaaaag
ggaggctctggtgacagtcctgatagtgatgacgaggagaactattttatctgttctata
acagaagaccccagaactgttaaaactgcagcccagaacacaccctctaattatctcaaa
aaccatctaaggagtgaagaacaatatggagtcagctcttctccaaagccctcattcaag
aatgaaatgcagcctcccgttaagcttggctccttgcatgatcaaggtcgggagacctgg
aggttagcagttcagaaggctaaacaaatgcctgatccttgggccgagttccatctggag
gaaattgaaaccgaatcagctatccgttacaggtacagtgctattacaggggagtgggcg
gaagatgaagtgctaattaaaatggcaaaacagccctttggtcggggcgctatgagggag
tgctacagaacgaaaaagctgtcaaacttttcacacagccagcactggaagtcagccttc
aactatgtagcaaagcgatacattgagactgtagaccgggatgtgtatttcgaagatgtg
aagcttcaaatggaagcaaagttgtggggagaggagtacaataggcacaagccaccaaaa
caggttgatattgtgcagatgtgtatactggagatgaaagacaggccaggtaatccactg
tttcacctggaacattacatcgagggcaaatacatcaaatacaactcaaactctgggttt
gtgcgagatgacaatattcgccttacaccacaggccttcagtcacttcacctttgagcgt
tcaggccatcagctgattgtagttgatatccagggtgttggagatctctatacagaccct
cagatccacacagaaagtggcgatagctttggagatggcaacctgggcgtacgaggtatg
gctctgttctttcattctcattcctgcaaccggatttgcaaaagtatgcgacttactccc
tttgatctttcatcgaaagaaaaagctgccttggatcataccaataagttattgcaatct
gctcagactgttctgcgagggactgaggagaaatgtggcagcgacagggtcaggaccatt
tcagggagccgaccccctctactcttccgactctcagagaattctggagatgagaacatg
agtgacaatgcattcgactccttgccttgctccccttccacaccaatacaacagagtccc
cttggttggcctgagcttaatgaagatcggttccagggtcaagatgacaacaacaacctt
gagaaccacagggactctgaaagcggtggtgacagtgggtaccccagtgaaaggaggagt
gagctggaagaaatggagccgagagacagggccagttcaaactccagaagacgttatgac
tcagacgacgacagtttctcaaggagaaaagctgttgtttctaaactctccttgacccct
aaaaacagtctacggaaaaagatgctcaccaccgaaaactggaacttcttcaattcctct
cgcactcatatacacagaccgtcctgtgttgctgtggaaatgcaaagactggatgctctt
gaacttgaaaagaaaattggaaagtcaatcctcggaaaggttcacttggccatggtgcgg
taccatgaagctggtcgattctgtgaaaaggatgaggaatgggattgggaatcggccctt
tatcatcttgaacacgctgccctgtgtggtgaactggaagccattgtcggcctgggttta
atgcattcccagctgcctcatcacattctcagtgatgttaactccgaggacaccaaagag
aataagattaaaggattcaattaccttctgaagggagcagatgccggagacaggccttcc
atgattctggtagccagagcatatgatacaggcaataatcttggccctgatagaaagcag
gactgggttgaagctgtacactggtatgatatggttctgaacatgactgattacgatgaa
ggtggcgaatatgacgggacacaggatgaaccacaataccttctcttagcacgggaagct
gaaatgttcttgactggtggatttggtctggagaaggacccactgagatcaggtgatttg
tttaccgaagcagctgatgccgcaatggaagccatgaagggccggttggctaaccagtac
tatgagaaggcagaggaggcttgggcaatgatggaggattga

DBGET integrated database retrieval system