KEGG   Latimeria chalumnae (coelacanth): 102346183Help
Entry
102346183         CDS       T02913                                 

Gene name
GPT2
Definition
glutamic pyruvate transaminase (alanine aminotransferase) 2
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    102346183 (GPT2)
   01210 2-Oxocarboxylic acid metabolism
    102346183 (GPT2)
   01230 Biosynthesis of amino acids
    102346183 (GPT2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102346183 (GPT2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102346183 (GPT2)
Amino acid related enzymes [BR:lcm01007]
 Aminotransferase (transaminase)
  Class I
   102346183 (GPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 522 aa AA seqDB search
MNCFPAIVKSAFADHSSKLWMNEFSLRCFSSIVDRSWYKGQLKEGKGLAKLSTADAVEVK
ENGRSRHKILTLKTMNPQVKAVEYAVRGPIVIKAGEIEKELQQGIKKPFSEVIKANIGDA
HAMGQQPITFLRQVVALCTYPELLDSPSFPEDAKRRAERILQSCGGHSLGAYSASQGLDC
IREDVAMYMKKRDGGVPVDPNNIYLTTGASDGIANILKLLVSGEGNSRTGVMIPIPQYPL
YSAAISELGAVQINYYLDEENCWALDVNELRRAVNQAKEYCDPKVVCLINPGNPTGRIST
CSQREISEVQRQAEGENLATLKYCALQVYQDNVYAEGCQFHSFKKVLYEMGPEYFSSVEL
ASFHSTSKGYMGECGYRGGYMEVIHLDPEVKAQLVKLLSVRLCPPVPGQAAMDVVVNPPQ
PGEESYEQFIKVSVVFFSNILHVEREFLCALGGIRTDGFGRGGVVFGAVXLFLHVSGLCL
ETSSAHGMPPDMFYCMRLLEQTGICVVPGSGFGQKEGTYHFR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaattgctttccagctatcgtaaagtcagcttttgcagaccattcttccaaactttgg
atgaatgaattcagcttgcgctgcttttcttccattgttgaccggtcatggtacaagggc
caactcaaagaaggcaaaggattagctaaactgagcaccgctgatgctgtggaagtgaaa
gaaaatggcagaagtcgacacaaaattttgactttaaagactatgaatccacaggtaaag
gcggtggagtatgccgtcagaggtccgatagtcatcaaagccggggagattgagaaagag
ctgcagcagggaatcaagaagccttttagtgaggtcatcaaagcaaacatcggtgatgct
catgctatgggacagcagccaattaccttcctccgccaggttgtagcactctgtacgtac
ccagagctactggacagccccagcttcccagaagatgccaaaaggagagctgagcgaatc
ttgcagtcctgcggaggacatagtttgggtgcatacagtgccagtcaagggctggattgc
atccgtgaagatgtggcgatgtatatgaagaaaagagatggaggagtgcctgtcgatcct
aacaacatctatctcaccaccggagccagcgatggaattgctaacattctgaagctgttg
gtgtcaggggaggggaattcccggactggcgtgatgattccgatcccacagtacccttta
tattccgctgccatctctgagctcggcgctgtccagatcaactattacctggatgaggag
aactgctgggcgctagacgtgaacgagctccgcagagcagtgaaccaggccaaggaatat
tgtgatccaaaagtggtctgcctcatcaacccaggaaacccaacaggtaggatttccacg
tgctctcaaagagaaatctcagaagtccaacggcaggccgaaggagaaaatcttgccacc
ttaaagtattgcgctttgcaggtgtatcaggacaatgtctacgcagaaggatgccagttt
cactccttcaagaaggttctatacgagatgggacctgaatacttcagcagcgtagagctg
gcctcgttccattcaacttccaaaggatacatgggagagtgtggctacagaggcgggtat
atggaagttattcacctggatccggaggtaaaggctcagcttgttaagttactttccgtc
cgtctctgcccaccagttcctggccaggcggccatggacgttgtcgtaaacccaccacag
cctggagaagaatcctacgagcaattcatcaaggtcagtgttgtgttttttagcaatatt
ttgcacgttgagagggagtttctttgtgcactgggtggtattcgtactgatgggtttggc
agggggggggttgtctttggtgctgtgtagctctttctgcatgtttcaggtctttgcctt
gagacttcctccgctcatggaatgccaccagacatgttctattgtatgagactgttggag
caaacaggaatttgtgtcgttcctggcagtggctttggtcaaaaggaaggaacctaccat
tttaggtaa

DBGET integrated database retrieval system