KEGG   Latimeria chalumnae (coelacanth): 102346183Help
Entry
102346183         CDS       T02913                                 

Gene name
GPT2
Definition
(RefSeq) glutamic--pyruvic transaminase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00220  Arginine biosynthesis
lcm00250  Alanine, aspartate and glutamate metabolism
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
lcm01210  2-Oxocarboxylic acid metabolism
lcm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102346183 (GPT2)
   00220 Arginine biosynthesis
    102346183 (GPT2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102346183 (GPT2)
Amino acid related enzymes [BR:lcm01007]
 Aminotransferase (transaminase)
  Class I
   102346183 (GPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102346183
NCBI-ProteinID: XP_014353867
Position
Un
AA seq 555 aa AA seqDB search
MNCFPAIVKSAFADHSSKLWMNEFSLRCFSSIVDRSWYKGQLKEGKGLAKLSTADAVEVK
ENGRSRHKILTLKTMNPQVKAVEYAVRGPIVIKAGEIEKELQQGIKKPFSEVIKANIGDA
HAMGQQPITFLRQVVALCTYPELLDSPSFPEDAKRRAERILQSCGGHSLGAYSASQGLDC
IREDVAMYMKKRDGGVPVDPNNIYLTTGASDGIANILKLLVSGEGNSRTGVMIPIPQYPL
YSAAISELGAVQINYYLDEENCWALDVNELRRAVNQAKEYCDPKVVCLINPGNPTGRIST
CSQREISHLCSLNGARNSNFSCTICSTSLRKHVQVFRVAWTQPCCTDSEGYGVFFVKFCC
INVCSVQDCSEYCALQVYQDNVYAEGCQFHSFKKVLYEMGPEYFSSVELASFHSTSKGYM
GECGYRGGYMEVIHLDPEVKAQLVKLLSVRLCPPVPGQAAMDVVVNPPQPGEESYEQFIK
VSVVFFSNILHVEREFLCALGGIRTDGFGRGGVVFGAAHGMPPDMFYCMRLLEQTGICVV
PGSGFGQKEGTYHFR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaattgctttccagctatcgtaaagtcagcttttgcagaccattcttccaaactttgg
atgaatgaattcagcttgcgctgcttttcttccattgttgaccggtcatggtacaagggc
caactcaaagaaggcaaaggattagctaaactgagcaccgctgatgctgtggaagtgaaa
gaaaatggcagaagtcgacacaaaattttgactttaaagactatgaatccacaggtaaag
gcggtggagtatgccgtcagaggtccgatagtcatcaaagccggggagattgagaaagag
ctgcagcagggaatcaagaagccttttagtgaggtcatcaaagcaaacatcggtgatgct
catgctatgggacagcagccaattaccttcctccgccaggttgtagcactctgtacgtac
ccagagctactggacagccccagcttcccagaagatgccaaaaggagagctgagcgaatc
ttgcagtcctgcggaggacatagtttgggtgcatacagtgccagtcaagggctggattgc
atccgtgaagatgtggcgatgtatatgaagaaaagagatggaggagtgcctgtcgatcct
aacaacatctatctcaccaccggagccagcgatggaattgctaacattctgaagctgttg
gtgtcaggggaggggaattcccggactggcgtgatgattccgatcccacagtacccttta
tattccgctgccatctctgagctcggcgctgtccagatcaactattacctggatgaggag
aactgctgggcgctagacgtgaacgagctccgcagagcagtgaaccaggccaaggaatat
tgtgatccaaaagtggtctgcctcatcaacccaggaaacccaacaggtaggatttccacg
tgctctcaaagagaaatctcacacctatgctcactgaacggtgcgagaaattcaaatttt
tcttgcaccatctgtagcacaagcttacggaagcacgtacaggtttttagggtggcctgg
acgcagccgtgctgtacggattccgaaggttatggggttttttttgtgaagttctgttgc
ataaatgtttgttctgtccaagactgttcagagtattgcgctttgcaggtgtatcaggac
aatgtctacgcagaaggatgccagtttcactccttcaagaaggttctatacgagatggga
cctgaatacttcagcagcgtagagctggcctcgttccattcaacttccaaaggatacatg
ggagagtgtggctacagaggcgggtatatggaagttattcacctggatccggaggtaaag
gctcagcttgttaagttactttccgtccgtctctgcccaccagttcctggccaggcggcc
atggacgttgtcgtaaacccaccacagcctggagaagaatcctacgagcaattcatcaag
gtcagtgttgtgttttttagcaatattttgcacgttgagagggagtttctttgtgcactg
ggtggtattcgtactgatgggtttggcagggggggggttgtctttggtgctgctcatgga
atgccaccagacatgttctattgtatgagactgttggagcaaacaggaatttgtgtcgtt
cctggcagtggctttggtcaaaaggaaggaacctaccattttaggtaa

DBGET integrated database retrieval system