KEGG   Latimeria chalumnae (coelacanth): 102346400Help
Entry
102346400         CDS       T02913                                 

Gene name
MGEA5
Definition
meningioma expressed antigen 5 (hyaluronidase)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102346400 (MGEA5)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     102346400 (MGEA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 820 aa AA seqDB search
MTLISAAHEYGIEFIYAISPGLDITFSNQKEVCTLKRKLDQVSQFGCKSFAILFDDIDHN
MCPADKEVFSSFAHAQVSSTNEIYQYLGEPSTFLFCPTEYCGTFCYPNVAQSPYLRTVGE
KLLPGVDVLWTGPKVVSKDIPVESIEEVSKILKRSPVIWDNLHANDYDQKRLFLGPYKGR
STELIPRLKGVLTNPNCEFETNFVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKL
ENEGSDEEIETDVLYSPQIALKLALTEWLQDFGIPHQFSSRQVPHSGPKTNVTDVTSLGS
PPTLVATTTVTTVYQQPIMSQGAALTGEQTSLVKEEEEKKQQSDEEPMEMVVEKPDDPEA
DAKNVNEILTEIVKAKMTEELKPMDTDKESIAESKSPEMSMQEDSGSDIAPMQTDDQLNK
DSYIPGPHDKPLYVAETVTLEDLNLLAELFYLPYEHGPKAVQLLREFQWLRANSSVVSVN
CKGKDNEKIEEWHSKAAKFEELCGSVMKMFTRLSNCANRTILYDLYPYIWDIKSIISMVK
SFVQWLDGRILSTSFYCYWMDNSRWCRSQSSAQFLSGDQEPWAFRGGLAGEFQRLLPIDG
ANDLFNQPPPLMPTSKVYTIRPYYPKDEASVYKICREIYGEGMDDQPFSEQPDLIGDRLI
GGLLALSLDYCFVLEDEDGICGYALGTVDVRPFVKKYKMSWLPSMQEKYSKPDSEKTLSE
AEKMMLSFHEEEEGLPEAFLSHFPSLIKVDIHRKVVDPSVAKSMMACLLSSLKANGSHGA
FCEVRPNDKRILEFYSRLGCFEITKNDGFPQNVIILGRAL
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgatctctgctgctcatgaatatggaattgaatttatctacgccatctcgccc
gggcttgacatcaccttctcaaaccagaaggaagtgtgtacactgaagcgcaaattagac
caggtttcccagttcggctgcaagtcttttgcgatactctttgatgacattgaccacaat
atgtgcccagcagacaaggaggtgttcagctcatttgcacatgctcaggtttcaagcacg
aatgagatctaccagtatttaggagaaccttccaccttcttgttctgtccgacagagtat
tgtggtactttctgctatccaaatgttgcccaatctccttatctccggactgttggagag
aagctactacctggagtcgatgtgttatggacgggaccaaaagttgtatcaaaagacatt
ccagttgaatcaattgaagaagtctccaaaatcctgaagaggtctccagtgatctgggac
aaccttcatgccaacgactatgatcaaaagagactgttcctggggccgtacaagggccgt
tccacagagctaatccccaggctcaagggcgttttaaccaatcctaactgtgaatttgaa
accaacttcgtagctattcatacgctggcaacgtggtacaaatcgaacatgaatggagtg
aggaaggacgtggtgatgactgacagtgaagacagtacagtatccatccagataaagctg
gaaaatgaaggcagcgatgaggagattgaaacagatgttttatacagccctcagatcgca
ctgaagctggctttaacagagtggctgcaggactttgggataccccatcagttcagcagc
cgtcaagtaccccatagtggtcccaagacaaatgtgacagacgtgacctctcttggctcc
cctccaactttggttgctaccacaaccgtcaccacggtgtaccaacagccaattatgagc
cagggggcagcgcttactggcgaacagacctccctggtcaaggaggaggaagagaagaag
cagcagtcggacgaggagcccatggagatggtagttgagaagccggacgaccctgaggca
gatgctaaaaacgtcaacgagatactgactgaaattgtgaaggccaaaatgacagaggag
ctgaagccgatggacacggacaaagaaagcatagcggagtccaagtctcctgagatgtcc
atgcaggaggactccggcagtgacattgcccccatgcagaccgacgatcagttaaataag
gactcctacatacccgggccccatgacaagccgctctacgttgcagagactgtaacactg
gaggacctgaacttgttggccgaactcttctacctcccttacgagcatggccccaaggcc
gtccagctgctgagagaattccagtggcttcgggcgaacagcagtgtcgtcagtgttaac
tgcaagggaaaggataacgaaaagattgaggagtggcactcaaaagcagccaagttcgaa
gagctctgtggctcggtgatgaaaatgttcacccgcctctcaaactgtgcgaacaggaca
atactgtacgacctttacccttacatctgggacatcaagagcatcatctccatggtgaaa
tcatttgtacagtggttagatgggagaatcctcagcaccagtttctactgctattggatg
gacaactccagatggtgtcgtagtcaatcttcagcacagttcttgagtggagaccaagaa
ccctgggcctttagaggtggtctagcaggagagttccagcgcttactgccaattgacggg
gcaaatgaccttttcaaccagccaccgccgttgatgccaacttccaaagtttatacgata
agaccttactatccaaaagatgaagcatcagtttacaagatctgcagggagatttatggt
gagggaatggatgaccaacctttctcagagcagcctgatctcattggagataggttaata
ggtggtcttcttgccttaagtctggattattgtttcgtcctggaggatgaggacggtatc
tgtggatatgcattgggaacggttgatgtaagaccctttgtcaagaagtataaaatgtct
tggctcccctccatgcaagaaaagtacagcaaaccagattcggaaaaaaccctatccgag
gcagagaagatgatgctgagctttcatgaagaagaagagggattaccagaggctttcctt
tctcatttcccgtctttaattaaggtggacattcatcgaaaagtcgtggaccccagtgtt
gcaaaaagcatgatggcgtgtctgctctcctctcttaaggcaaatgggtcccacggggcg
ttctgcgaagtaagaccgaatgacaaacggattttggaattctacagcaggctgggctgc
ttcgaaataaccaaaaacgatggatttccacagaatgtgattatccttggaagagccctg
tga

DBGET integrated database retrieval system