KEGG   Latimeria chalumnae (coelacanth): 102348144Help
Entry
102348144         CDS       T02913                                 

Definition
protein-glutamine gamma-glutamyltransferase 2-like
Orthology
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
lcm  Latimeria chalumnae (coelacanth)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 684 aa AA seqDB search
MTAPDNLLGVVDLHCNYNNTAHHTDEIDSERLVVRRGQPFTITVECRSGLFHPGRDQLAI
VLDIGQKPSTDNGTRIKISSSDAKAEKWRFAMQADQYELQLTLYSPADAPVGQYTILLLV
HSDSKLIQKKAAGQFYLLFNPWCKDDTVYLPDKEMLNEYIMNENGQLYQGSWNDIYPVSW
NFGQFEKDVVDICFEILDNSLPALNNPVADILKRKDPIYVSRIVSAMVNANDDKGVLLGR
WDGNYFDGIPPTRWNGSVQILRQWSKSGAKKVRYGQCWVFAGLACTVLRCLGIPTRCITN
YYSAHDTDGNLKVDKCFNEDLDVLPGKRKDMIWNFHCWVESWMTRQDLPSGYDGWQVLDP
TPQERSDGIYCCGPCPIKAIKEGNINVKYDASFVFAEVNADVTCYIVKKDGTKSETAVYC
HQVGKCISTKSIFGDNREDITEQYKYPEGSSKEREVYAKAGLKNRLVSSNTKDVLIAIKH
TRAVHGSDFDIFIEVCNNSSVDKDVGVTIVAKTVTYNGIILKDCHKKITSFSLMASNAKK
EVFRLKYEHYGEHLSEHNLIRITALLLQKGKNELILTERDIALAMPQLTVKILGEPMVSR
KLKAHIKFVNPLPITLTDGIFTVEGAGLTDLQEIKCPGKIKPGEEVTVDVSFIPTKTGLR
KLLVDFDTSRLRDVKGYASVIIKG
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacctgacaatttgctgggagttgtagacttacattgtaactacaacaacact
gcccaccatactgatgagatcgactcagagaggcttgtggtaaggagaggacaacccttc
actatcacagtagaatgcagaagtgggctattccacccaggaagagaccaactggcaatt
gtactagatattggacaaaagccctcaacggacaatggaacaagaattaagatatcaagt
tcagatgctaaggcagagaaatggaggttcgctatgcaagcagaccaatatgaattacaa
ctcactctgtacagccctgcagatgcacctgtgggacagtacacgattttgcttctggta
cacagtgatagcaaattaatccaaaagaaagcagctggacaattctatcttctcttcaac
ccctggtgtaaagatgatacagtgtatctgcctgataaggaaatgctaaatgagtacatc
atgaatgaaaatggacaactctaccaaggatcttggaatgatatctatcctgtatcttgg
aactttggacagtttgaaaaggacgttgtggacatctgttttgaaatcctggacaacagc
cttccagctctgaataatccagtggctgacattctaaagaggaaggatcctatttatgtc
agcaggattgtgtctgcaatggtgaatgccaatgatgataaaggtgtacttttaggaaga
tgggatggtaattattttgatgggattcctcctaccagatggaatggtagtgtacagatt
ctccgccagtggagcaaatcaggagctaagaaggtgcgatacgggcagtgctgggtattt
gcagggctagcctgcacagtcttgcgatgtctgggaattcctactcgctgtataactaac
tactattctgctcatgacacggatggcaatttgaaagttgacaagtgtttcaatgaagat
ttggatgttctgccagggaagagaaaagacatgatatggaatttccattgttgggtggag
tcatggatgacccgtcaagaccttccctcggggtatgatggttggcaagttctggatcca
actccacaggaaagaagcgatggtatatactgctgtggtccttgccctattaaagctatc
aaggaaggcaatatcaatgtgaaatatgatgcttcatttgtttttgctgaagtaaatgca
gatgtgacttgttatattgtgaaaaaagatggaactaaatctgaaacagctgtttactgc
caccaagtggggaagtgtatcagtaccaagagtatctttggtgataacagagaagacatt
actgaacaatacaagtacccagaaggttcttcaaaagaaagagaagtgtatgctaaggct
ggcttgaaaaacagactggtatcatcaaacacaaaagatgtactaatagccatcaagcat
acccgggctgtccatggcagtgattttgatattttcattgaagtttgtaataacagctct
gtggataaagatgttggagtaacaattgtcgcaaaaacagtgacatataatggaataatt
ctgaaagactgccataagaaaataacttcgttctcattaatggcttccaatgctaagaaa
gaagtcttcaggctgaaatatgaacattatggagaacatttatcagaacacaatctgatc
cggatcacagctctgcttttacagaagggcaaaaatgaacttattcttaccgaaagagat
attgccctggccatgccacagctaacagtgaagatccttggagaaccaatggtatccaga
aaacttaaggctcatattaaatttgtgaacccattgccaattactttgacagatggaatt
ttcactgtggaaggagctgggctaacagaccttcaagaaattaaatgcccaggaaagata
aaacctggagaggaagtcactgttgatgtgtcattcatccctaccaagactggactgcgc
aagctccttgtggattttgataccagtcgactcagagatgtgaaaggctatgctagtgtc
attataaaagggtag

DBGET integrated database retrieval system