KEGG   Latimeria chalumnae (coelacanth): 102349342Help
Entry
102349342         CDS       T02913                                 

Definition
(RefSeq) erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Organism
lcm  Latimeria chalumnae (coelacanth)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 289 aa AA seqDB search
MRNLGITLLFPAILILFVVSELECAEELEFERFDEAQMEASIVMGMAENSVDDDYNGCVQ
GVSQQIPRVLQNEKNANQNFKMAWNEAANLWNWKKFHLPNGMRAEHAIAIIAYTRNKVYR
DFNAKTRDYGRWLRQYPYKSFHFLLTRAIQILTRWPLIVHCKNVYRGTNLDFQTSIGASV
RFGQFTSTSRSQAIANNFGSRTRFKITTCFGASIMEYSSYKNEQEVLIPPTEMFKVTRFI
RNYYTTIIELTSTMRSYSRFRCQLFRATSYAPKAWSGNKSFRKVRTIHL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaccttgggatcaccctcctgtttccagccattttaatactgtttgtagtctct
gagctggaatgtgcagaagagcttgagtttgaaagatttgatgaggctcaaatggaagca
tcgatagtgatgggcatggcggagaattctgttgatgatgattataatgggtgtgtccaa
ggtgtgagtcaacagatacccagagtgcttcagaatgaaaagaatgcaaatcaaaatttt
aaaatggcatggaatgaagcagcaaatttgtggaactggaaaaagtttcaccttccaaac
ggcatgagggctgagcatgcaattgcaattattgcttacactaggaataaagtttaccgg
gacttcaatgctaaaacaagagattacggaagatggctaaggcaatatccttataaatcc
tttcactttcttctaacccgtgcaattcagattctaaccaggtggcccttaatcgtacat
tgcaaaaacgtatataggggaaccaacctggactttcagacaagcattggagcatcagtc
aggtttgggcagtttacctcaacttccagaagtcaggcgatagccaacaattttggtagc
agaacaaggtttaagatcacgacatgctttggagcatcaataatggaatattcaagttat
aaaaatgagcaggaggtgctgattccacccacagagatgtttaaagtaacaaggtttatc
agaaattattataccaccatcattgaactaacatcgacgatgagatcttacagcaggttt
cgatgtcagctttttagagctacctcctatgctcccaaggcctggagtgggaacaagagt
ttcaggaaggtgagaacaatacatctttga

DBGET integrated database retrieval system