KEGG   Latimeria chalumnae (coelacanth): 102349342Help
Entry
102349342         CDS       T02913                                 

Definition
erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102349342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 270 aa AA seqDB search
MELECAEELEFERFDEAQMEASIVMGMAENSVDDDYNGCVQGVSQQIPRVLQNEKNANQN
FKMAWNEAANLWNWKKFHLPNGMRAEHAIAIIAYTRNKVYRDFNAKTRDYGRWLRQYPYK
SFHFLLTRAIQILTRWPLIVHCKNVYRGTNLDFQTSIGASVRFGQFTSTSRSQAIANNFG
SRTRFKITTCFGASIMEYSSYKNEQEVLIPPTEMFKVTRFIRNYYTTIIELTSTMRSYSR
FRCQLFRATSYAPKAWSGNKSFRKVRTIHL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaatgtgcagaagagcttgagtttgaaagatttgatgaggctcaaatggaa
gcatcgatagtgatgggcatggcggagaattctgttgatgatgattataatgggtgtgtc
caaggtgtgagtcaacagatacccagagtgcttcagaatgaaaagaatgcaaatcaaaat
tttaaaatggcatggaatgaagcagcaaatttgtggaactggaaaaagtttcaccttcca
aacggcatgagggctgagcatgcaattgcaattattgcttacactaggaataaagtttac
cgggacttcaatgctaaaacaagagattacggaagatggctaaggcaatatccttataaa
tcctttcactttcttctaacccgtgcaattcagattctaaccaggtggcccttaatcgta
cattgcaaaaacgtatataggggaaccaacctggactttcagacaagcattggagcatca
gtcaggtttgggcagtttacctcaacttccagaagtcaggcgatagccaacaattttggt
agcagaacaaggtttaagatcacgacatgctttggagcatcaataatggaatattcaagt
tataaaaatgagcaggaggtgctgattccacccacagagatgtttaaagtaacaaggttt
atcagaaattattataccaccatcattgaactaacatcgacgatgagatcttacagcagg
tttcgatgtcagctttttagagctacctcctatgctcccaaggcctggagtgggaacaag
agtttcaggaaggtgagaacaatacatctttga

DBGET integrated database retrieval system