KEGG   Latimeria chalumnae (coelacanth): 102350028Help
Entry
102350028         CDS       T02913                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    102350028 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102350028 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102350028 (SCD5)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102350028 (SCD5)
Lipid biosynthesis proteins [BR:lcm01004]
 Desaturase
  First
   102350028 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 340 aa AA seqDB search
MYCELDVLVITDLKLEFTEALRNELEYYVLTGEHKLEHMSVLETILYSSATAIVEKKMSS
QHSACHLFMTILFLIVWYKNPFVLCLPAYLCFLVTALGVTAGAHRLWSHRSYKAKLPLRI
FLAAANCMAFQNDIFEWSRDHRAHHKYSETDADPHNATRGFFFAHIGWLFVRKHRDVIDK
GRKLNVDDLLMDPVVVFQRRYYKTSVLTMCFLIPTLVPWYFWGETLWNAYFLASILRYTV
SLNVTWLVNSAAHMYGNRPYDKHISPRENKFVTLGAIGEGFHNYHHTFPFDYSTSEFGLR
LNPTTCFIDFMCWVGLASDRKRASKQMILSRKQRNGDGSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtattgtgaattggatgtcttggtcataactgacttgaagcttgagttcacagaggcc
ttgagaaatgaattagagtactatgtcctcactggagaacacaaactggagcacatgtca
gttctggaaaccatcttgtattcatctgcaactgcaattgttgaaaagaagatgtcttct
cagcattccgcttgtcatctgttcatgaccatcttgtttctcattgtttggtataaaaat
ccttttgttttgtgtcttccagcttacttgtgtttcctagtaacagctcttggggtgaca
gctggtgcacatcgtttatggagtcacaggtcatacaaagccaagcttccactaagaata
ttcctggctgcagccaactgcatggcttttcagaatgacatttttgagtggtcccgtgat
catcgagctcaccacaagtactctgagacggatgctgacccacacaacgccacccgtgga
ttcttctttgcccacataggctggctctttgttcggaagcacagagacgtgatagacaag
ggacgaaaattgaatgttgatgatctcttaatggaccctgttgttgtatttcaaagaagg
tactacaagacctcagttctaacaatgtgtttcctgatcccaactcttgttccctggtat
ttctggggagagacgctgtggaatgcctacttcctcgcatccatccttcgttacacagtc
tctttgaatgtcacatggttggtgaacagtgctgcccacatgtatggaaatcgtccatat
gacaagcacatcagtcccagggaaaataaatttgttactcttggagctattggagaaggc
ttccataattaccatcacaccttcccctttgattactccacgagcgagtttggcttgagg
ctgaatccgacgacctgtttcattgacttcatgtgctgggttgggctggcgagcgaccgg
aaacgagcttccaagcagatgatcctgagccgcaaacagaggaatggggatggaagtgcc
tga

DBGET integrated database retrieval system