KEGG   Latimeria chalumnae (coelacanth): 102350028Help
Entry
102350028         CDS       T02913                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lcm01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lcm01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:lcm03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 340 aa AA seqDB search
MYCELDVLVITDLKLEFTEALRNELEYYVLTGEHKLEHMSVLETILYSSATAIVEKKMSS
QHSACHLFMTILFLIVWYKNPFVLCLPAYLCFLVTALGVTAGAHRLWSHRSYKAKLPLRI
FLAAANCMAFQNDIFEWSRDHRAHHKYSETDADPHNATRGFFFAHIGWLFVRKHRDVIDK
GRKLNVDDLLMDPVVVFQRRYYKTSVLTMCFLIPTLVPWYFWGETLWNAYFLASILRYTV
SLNVTWLVNSAAHMYGNRPYDKHISPRENKFVTLGAIGEGFHNYHHTFPFDYSTSEFGLR
LNPTTCFIDFMCWVGLASDRKRASKQMILSRKQRNGDGSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtattgtgaattggatgtcttggtcataactgacttgaagcttgagttcacagaggcc
ttgagaaatgaattagagtactatgtcctcactggagaacacaaactggagcacatgtca
gttctggaaaccatcttgtattcatctgcaactgcaattgttgaaaagaagatgtcttct
cagcattccgcttgtcatctgttcatgaccatcttgtttctcattgtttggtataaaaat
ccttttgttttgtgtcttccagcttacttgtgtttcctagtaacagctcttggggtgaca
gctggtgcacatcgtttatggagtcacaggtcatacaaagccaagcttccactaagaata
ttcctggctgcagccaactgcatggcttttcagaatgacatttttgagtggtcccgtgat
catcgagctcaccacaagtactctgagacggatgctgacccacacaacgccacccgtgga
ttcttctttgcccacataggctggctctttgttcggaagcacagagacgtgatagacaag
ggacgaaaattgaatgttgatgatctcttaatggaccctgttgttgtatttcaaagaagg
tactacaagacctcagttctaacaatgtgtttcctgatcccaactcttgttccctggtat
ttctggggagagacgctgtggaatgcctacttcctcgcatccatccttcgttacacagtc
tctttgaatgtcacatggttggtgaacagtgctgcccacatgtatggaaatcgtccatat
gacaagcacatcagtcccagggaaaataaatttgttactcttggagctattggagaaggc
ttccataattaccatcacaccttcccctttgattactccacgagcgagtttggcttgagg
ctgaatccgacgacctgtttcattgacttcatgtgctgggttgggctggcgagcgaccgg
aaacgagcttccaagcagatgatcctgagccgcaaacagaggaatggggatggaagtgcc
tga

DBGET integrated database retrieval system