KEGG   Latimeria chalumnae (coelacanth): 102350315Help
Entry
102350315         CDS       T02913                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lcm  Latimeria chalumnae (coelacanth)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 676 aa AA seqDB search
MDASNVESGPPVADANTETTIFSMVDVFLVSLISGLLVYWLVFRKKKEEIPEFKPIKPVA
LTPRETSFVEKMKKTGKNIVVFYGSQTGTAEELANRLSKDAQRYGMRGMAADPEEYQMCE
LSRLSEIDNSLAVFCMATYGEGDPTDNAQDYFDWLQETDEDLSGVKYAVFGLGNKTYEHF
NAMGKYVDKRLNELGAQRMFDLGVGDDDGNLEEDFISWREQFWPAVCEHFGVEATGEDSS
IRQYELVVHMDINMNKVYSGEMGRLKSYEIQKPPFDAKNPYLGVVSVNRKLNKGGERHLM
HIELDIAGSKIRYESGDHVAVYPSNDIALVNEMGKILNTDLDTVFSLNNLDEESNKKHPF
PCPTTYRIALTHYLDITNPPRTNVLYELAQYATNAQDQEFLRKMASSSPEGKEQYLSWVV
EARRNILAILQDLPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVVVEYETK
TGRINKGVATNWLKNKVPTDNGHKSSVPMYVRKSQFRLPFKPSTPVIMIGPGTGIAPFIG
FIQERAWQGQQGKEVGETVLYYGCRHKKEDYLYQEELEQFQGDGVLTQLNVAYSRDQAEK
VYVQHLLKKNKEHIWKLIHQDNAHIYVCGDARNMARDVQNAFYDIVMEFGEMTRTQAVDY
VKKLMTKGRYSCDVWS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttccaatgtggaatctggtccgcctgtagcagatgctaacacagagaccacc
atcttcagcatggttgatgttttcctggtttcgcttatctctggattgcttgtttactgg
cttgtcttccggaaaaagaaggaagaaatccctgagttcaagccaatcaagcctgtggca
cttacaccaagagaaaccagctttgttgaaaagatgaagaaaactggcaaaaacatagta
gtgttttatggctcccaaacgggaacggcagaggaacttgctaatcgtctttctaaagat
gctcagcgttatggcatgagaggcatggcagcggatccagaagagtatcagatgtgtgaa
ctgagccgcctatctgagattgataactctttggctgtgttctgtatggcaacctatgga
gaaggtgacccaacagacaatgcccaggactactttgactggctacaggaaactgacgaa
gatctatcgggggtcaaatacgcagtctttgggcttggaaacaagacctacgagcacttt
aatgcaatggggaagtatgtggacaagaggctgaatgaactcggggcccagagaatgttt
gacctcggagtgggggatgatgatggaaatttagaggaggatttcatctcgtggcgtgag
cagttctggccggcagtttgtgaacactttggtgtggaggcgacaggagaggactctagc
attcgtcagtatgagttggtagttcacatggatattaatatgaacaaggtttactcgggt
gaaatgggacgcttgaagagctatgagatccaaaaacccccctttgatgcaaagaaccct
taccttggtgtggtttctgtgaacagaaaactgaacaagggaggagagcgacacttaatg
cacattgagcttgatatcgctggctcaaagatcaggtatgaatctggagaccacgtggct
gtatatccctctaatgatatagcattggtgaatgagatggggaaaattcttaacacagat
cttgatactgtattctccttaaataatcttgatgaagagtccaataagaagcatcctttc
ccctgtccaaccacataccgcatagctctgactcactacctagatatcaccaaccctcca
cgtaccaatgtgctttacgagctggcacagtatgctacaaatgctcaagatcaggagttt
ctccgtaaaatggcttcttcctcccctgaaggaaaggaacagtatctcagctgggtcgtg
gaggccagaaggaacattctggccatcttgcaggacctgccttctctccgaccgccgatt
gaccatctgtgtgaattgttgccgcgtctacaggctcgctactactctattgcttcttcc
tcaaaggttcatcctaactcaatccatatctgcgctgttgttgtggagtatgagacaaaa
acaggacggattaacaaaggggttgctactaactggctaaagaataaggtgcccacagac
aatggccacaaatcatctgtgcctatgtacgtgcggaaatcccagttccgcctgcccttc
aaacccagcacccctgtgatcatgattgggcctggcaccggcattgctcctttcatcgga
ttcatccaggagagagcttggcaggggcagcagggtaaggaggttggtgaaactgttctc
tactatggctgccgtcataagaaagaagactatctgtaccaagaagagctggaacagttt
cagggggatggcgtactcactcagcttaatgtagcatactctagggatcaagctgagaag
gtttatgtacagcatttgctgaagaagaacaaggaacacatatggaaactgattcatcag
gataatgcacacatttatgtttgcggggatgcacgcaacatggctagagatgtacagaat
gcattctacgatattgttatggagtttggggaaatgacccgcactcaagcagtggactac
gtcaagaaactgatgaccaagggccgctactcttgtgacgtctggagctaa

DBGET integrated database retrieval system