KEGG   Latimeria chalumnae (coelacanth): 102350948Help
Entry
102350948         CDS       T02913                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00562  Inositol phosphate metabolism
lcm04012  ErbB signaling pathway
lcm04068  FoxO signaling pathway
lcm04070  Phosphatidylinositol signaling system
lcm04140  Autophagy - animal
lcm04150  mTOR signaling pathway
lcm04210  Apoptosis
lcm04218  Cellular senescence
lcm04370  VEGF signaling pathway
lcm04510  Focal adhesion
lcm04620  Toll-like receptor signaling pathway
lcm04625  C-type lectin receptor signaling pathway
lcm04810  Regulation of actin cytoskeleton
lcm04910  Insulin signaling pathway
lcm04914  Progesterone-mediated oocyte maturation
lcm04933  AGE-RAGE signaling pathway in diabetic complications
Module
lcm_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102350948 (PIK3CA)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102350948 (PIK3CA)
   04370 VEGF signaling pathway
    102350948 (PIK3CA)
   04068 FoxO signaling pathway
    102350948 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102350948 (PIK3CA)
   04150 mTOR signaling pathway
    102350948 (PIK3CA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102350948 (PIK3CA)
  Cell growth and death
   04210 Apoptosis
    102350948 (PIK3CA)
   04218 Cellular senescence
    102350948 (PIK3CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102350948 (PIK3CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102350948 (PIK3CA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102350948 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102350948 (PIK3CA)
  Endocrine system
   04910 Insulin signaling pathway
    102350948 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102350948 (PIK3CA)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    102350948 (PIK3CA)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102350948 (PIK3CA)
Membrane trafficking [BR:lcm04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102350948 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF4135 Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 102350948
NCBI-ProteinID: XP_005991994
Ensembl: ENSLACG00000015507
Position
Un
AA seq 1075 aa AA seqDB search
MPPRPSSGELWGIHLMPPKILVDCLLPNGMIVTLECLREATLVNIKRELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDPEVQDFRRNILNVCKEAVDLRDVNGSHSRALYVYPPNVESSPELPKH
IFSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLSRMPNLMLMTKESLYSQLPVD
TFTMPSYSRRISTATPYMNGEASAKSLWILSGPLRIKILCATYVNVNIRDIDKIYVRTGI
FHGGEPLCDNVNTQRVPCSNPRWNEWLKYDIFIHDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGMEDLLNPIGGTGSNPNKETPCLELEFEWF
SSPVKFPDMSAIEDHANRAVSRELGLNYFQAGVSSRTARDSGLTDGDKEQLRAVGNRDPL
SEITEQEKDFLWRNRQFCVNLPEVLPKLLLSVKWNSRDDLAQMYCLLKDWPPIKPEQAME
LLDCNYPDPMVRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVTQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDVLIACYCENLHNSLSDLIKLLLGTSLSICLTIVKM
LPYGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHALHQWLKDKNKGEMYDAA
IDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVP
FVLTQDFLIVISKGAQECTKTREFERFQETCYKAYLAIRQHANLFINLFSMMLGSGMPEL
QSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgccacctagaccatcatcgggtgaactttggggcatccatttaatgccccctaaaatc
ctggtagactgtctgctacctaatggaatgatagtaactttagagtgcctccgtgaggca
acgcttgtgaatattaaacgtgaactttttaaagaagctcgaaagtaccctctgcaccag
ttgttgcaggatgagtcttcgtatattttcgtcagtgttacacaagaggcagagcgagag
gagttttatgatgaaactcgacgactttgtgaccttagactttttcagccatttctaaaa
gtcatagagccagtaggcaacagggaagagaaaattcttaaccgagaaattggttttgct
attggcatgcctatttgtgaatttgatctcgtcaaggatcctgaagttcaggacttcaga
agaaacatcctcaatgtttgtaaagaagcagtggaccttcgggatgtaaatggatcccat
agccgagcactttatgtttacccacctaatgtagaatcctcaccagaacttccaaaacac
atctttagtaaattggataaagggcaaattattgtagtgatttgggtgatagtgtctcca
aacaatgacaagcaaaaatacactctcaaaatcaaccatgactgtgtgcctgagcaggtg
attgcggaggcaatccggaagaaaacgaggagcatgttactttcacctgaacagctaaaa
atgtgtgttctggagtaccagggcaaatatattctaaaggtttgcggttgtgacgaatac
ttactagagaagtaccctctaagtcagtataagtacataagaagttgtatcatgcttagt
cgaatgcccaatctgatgctgatgactaaagagagcctatatagccagctgccagtagac
actttcaccatgccatcctattcacgtcgcatctccacagcaacaccatacatgaatgga
gaagcttctgccaaatccctttggattctcagtggtccactcagaataaaaatcctatgt
gctacttatgtgaatgtaaacattcgggatattgacaagatctatgtgcgaactggcatc
ttccatggcggtgagccattatgtgataatgtgaatactcagagggtaccatgttctaat
cccaggtggaacgagtggctaaagtatgacatttttatacatgatcttccacgtgcagct
cggctctgcctttccatctgttcagtcaaaggcaggaaaggtgctaaagaggaacactgt
ccacttgcatgggggaatataaacttatttgattatacagacacacttgtttctggaaaa
atggcactgaatctatggcctgtgccacatggaatggaagatttgctaaatcctattggt
ggtactgggtcaaatccaaataaagaaactccatgtttagaactagaatttgaatggttt
agcagtccagtaaaatttcctgacatgtctgcaattgaagaccatgctaatagggctgtc
tccagggaactgggattaaactatttccaggcaggggtgagtagcagaacagctcgagac
agcggattaacagatggtgacaaggagcaactccgtgcggttggaaacagagatccactt
tctgaaatcactgagcaagaaaaagacttcttatggagaaatcgacagttctgtgtgaat
ctccctgaagttctccccaagctacttctgtcagtcaaatggaactccagagacgattta
gcacagatgtattgtctgttaaaggactggcctcccattaagccagaacaggctatggag
ctgctagactgcaactaccctgacccaatggtgcgagattttgctgtaaggtgcctagag
aaatacctgaccgatgacaaactctctcagtacctaattcaactggtacaggttttgaag
tatgagcagtatttagataatccactggtgagatttttactgaaaaaagcactaaccaat
cagagaataggacatttcttcttttggcacttaaagtctgaaatgcataataaaactgta
acccagaggtttggactgctgctggagtcctattgtcgagcgtgtggcatgtacttaaaa
catttaagtaggcaagtggaggccatggagaaacttatcaaccttacagatattctcaaa
caagagaaaaaggatgaaacacaaaaggtgcaaatgaagttcctggttgaacagatgagg
agaccagactacatggatgccttgcaggggtttatttcccctcttaatcctgcacatcag
ctaggcaatctaaggcttgaagaatgtagaattatgtcctctgcaaaaaggccactctgg
ttgaactgggaaaatccagatataatgtctgaactgctattccaaaacaatgaaataatt
tttaaaaatggagatgtcttaattgcatgttactgtgaaaatttgcacaatagtttgtca
gacttgatcaaactactactaggtactagtctgtccatctgtctgactattgttaagatg
ctaccttatggttgcttgtctattggcgattgtgttggacttatcgaggttgtgagaagc
tcccacacaattatgcaaattcagtgtaaaggtggtctgaagggagcactacagttcaac
agccacgcattacaccagtggctcaaagacaagaacaagggagagatgtatgatgcagca
attgacttgtttacacgctcctgtgctggttattgtgttgccacctttattctgggaatt
ggtgatcgtcataacagtaacatcatggtcaaggatgatggacaactattccacattgat
tttggtcactttctcgatcacaagaagaaaaaatttggttacaaacgggagcgagtgcca
tttgtgttaactcaagacttcttaatagtaattagtaaaggagcacaagaatgtaccaaa
acaagggaatttgaaaggtttcaggagacgtgttacaaggcttatttagcaattcgacaa
catgcaaacctcttcattaaccttttttccatgatgctcggctcgggaatgccagagctt
cagtcctttgatgacattgcctatattcgaaaaacactagcattagataaaactgagcaa
gaagctcttgagtatttcatgaaacagatgaatgatgcccatcatggtggctggacaaca
aaaatggattggatcttccatacaatacgacagcatgccttgaactga

DBGET integrated database retrieval system