KEGG   Latimeria chalumnae (coelacanth): 102352401Help
Entry
102352401         CDS       T02913                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00220  Arginine biosynthesis
lcm00250  Alanine, aspartate and glutamate metabolism
lcm00471  D-Glutamine and D-glutamate metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102352401 (GLS)
   00220 Arginine biosynthesis
    102352401 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102352401 (GLS)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102352401 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF2087 AcylCoA_dehyd_C
Motif
Other DBs
NCBI-GeneID: 102352401
NCBI-ProteinID: XP_014344165
Ensembl: ENSLACG00000016381
Position
Un
AA seq 648 aa AA seqDB search
MLQVRSSAALLRGLFQVSLKQPLAGVFLTSRAGLGSYCFTGGKGELRGHPAHKLCFSIRG
PWALLQQQAAGRRALRGRCRGLCTKSEGAQQPDSVNQRVNNNHGEPIGEKEKQESLLPSL
EDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDFLRVTLQTTSDGVMLDKEL
FKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYENAKPMSGGKVADYIPQLAKFSPD
LWAVSLCTVDGQRHSVGDTKVPFCLQSCVKPLKYAIAVNDLSTEYVHRYVGKEPSGLRFN
KLFLNEEDKPHNPMVNAGAIVITSLIKQGANNAEKFDYVMQFFNKMAGNEYVGFSNATFQ
SERETGDRNFAIGYYLKEKKCFPEGTDMVTILDFYFQLCSLEVTCESASVMAATLANGGF
CPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMGVM
CWSPPLDKLGNSVRGIHFCQELVSLCNFHNYDNLRHFAKKLDPRREGGEQRVKSVINLLF
AAFTGDVSALRRFALSAMDMEQRDYDSRTALHVASAEGHVEVVRFLLEACKVNPFPKDRW
GNTPMDEAIHFGHHDVLTILQEYQNKYTPLEDNNNEKENQTKNLDSML
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggtgaggagctcggctgcgttgttacggggtttgtttcaggtgagcctgaag
cagccgttggccggtgtctttctaacgagcagagctggcctgggctcctattgctttacc
ggtggaaagggcgagctgcggggccacccggcgcacaagctctgcttttcgattcgtgga
ccttgggccctgctgcagcagcaggcggccggtaggagggcgctgcggggccgctgcagg
gggctctgcaccaagtcggagggagcccagcagcccgattccgtgaaccagcgggtcaat
aataaccacggcgagccgataggggagaaggaaaagcaggaaagtctcttacctagtctg
gaggatcttcttttctataccattgctgaaggacaagagaagataccagttcataagttt
atcacagcactaaaatctactggattacgaacttcagatccaaggttgaaggaatgtatg
gatttcttgagagttacacttcagacaacctcagacggagtaatgttggacaaagagcta
tttaaaaagtgtgtacaaagcaacattgtattgctgactcaggcttttagaaggaagttt
gtcattccagattttatgtcctttacttcacatattgacgagctgtatgagaatgccaag
ccaatgtctggaggaaaggttgctgactatatccctcagctggccaaatttagtccagat
ttgtgggctgtttcactttgcactgtggatggacagaggcattcggttggagatactaaa
gttcccttctgtctgcagtcctgtgtgaagcctttaaagtatgcaattgctgtgaatgac
ctttccacagagtatgtacacagatatgttggtaaagagccgagtggattacgtttcaac
aaactgtttctgaatgaggaagacaagcctcacaatccgatggtgaatgcaggagccatt
gtgattacttcacttataaagcaaggagcaaacaatgcagagaaatttgactatgtgatg
cagtttttcaataagatggctggaaatgagtatgttggcttcagcaatgccacctttcag
tctgaaagagaaactggagacagaaattttgccataggctactacttaaaggagaaaaag
tgtttcccagaaggcacagatatggttaccatattggacttttacttccagctgtgctcc
cttgaagtgacctgtgaatctgccagtgtgatggcagctactttggctaatggtggcttt
tgtccaattactggagagagagttctcagccctgaggccgtgcggaacacactgagtcta
atgcactcatgtgggatgtatgatttttcaggacagtttgccttccatgttggccttcct
gctaaatcgggggtttctggtggtattcttttggtggttccaaatgtgatgggtgtcatg
tgctggtccccacctttagacaaacttggcaacagcgtccgagggattcatttctgtcag
gagctggtttctctgtgcaatttccacaactatgataacttgaggcactttgcaaagaaa
cttgatccacgaagggaaggtggtgagcaacgggtgaagtcggtgataaatctacttttt
gctgcatttactggtgacgtgtctgcactcaggaggtttgctttgtctgctatggacatg
gaacagagagactatgattcacgaacagcattacatgtagcatctgcagaaggccatgtg
gaagtagttcgctttttgctagaagcctgtaaagtgaaccctttccccaaggataggtgg
ggcaacactccaatggatgaggccattcattttggacaccatgatgttttgacaatcctt
caggaatatcagaacaaatacacacccctagaggacaacaataatgaaaaagaaaatcag
acaaagaacctggatagcatgttgtaa

DBGET integrated database retrieval system