KEGG   Latimeria chalumnae (coelacanth): 102353168Help
Entry
102353168         CDS       T02913                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102353168 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2039 aa AA seqDB search
MVKRADPLYTEWILEAIQKVKRQKQRPSEERICHAVSASHGLDKKTVQEQLELSVQDGSI
LKVTNKGLASYKDPDNPGRLMPIKVGSFPKTIKGSNRASNDLCNVDWNKLLKRAIEGLGE
PSGSSLKNIEKFLRSQSDLASIISSPMFQRRLRLAAKRAVNNGRLFKYGRLYLFNYGNVE
GKGVPKYSSASTSSLLPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELISCADC
GSSGHPSCLKFSPELTANVKALRWQCIECKTCSACRVQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRALSVASAE
GSLTASAGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLAVTDPTRAGATTKFTTTTFTS
TSACTLKVNKKTKGLIDGLTKFFTPSPDGRRPRGEIVDFSKHYRPRKKGPPKQSCTSHFS
VLATGTTQKLKPTPCALPPPTPLPGQSPNSQKSSTSTSANSPQSSSSQSSVPSLSSLPSN
NQLKGLFDGLSHIFVTQGQSRKKGHPSYAPPRRMRRKSETSSAMSKSSPHFCGKKEIRNR
LVSHSSTSSGWGMVRGRAFKSIAHFRRASFFNKRHRLLGRLKYKVTPQMGTPSPGKGSLA
DGRIKPDQDDDTEGTKSFKQETADPGVIGSKENVTEEDLEIFKQAQELSLQKTGCVRAVD
PHGRYPAMIEFGKYEIQTWYSSPYPQEYARLPKLFLCEFCLKYMKSRNILLRHSKKCRWF
HPPANEIYRKNDLSVFEVDGNISKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDE
KGCHLVGYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYVLSRREGQAGSPEKPL
SDLGRLSYLAYWKSVVLQYLHHHPEKHISIKGISRATGMCPHDIAMTLQQLNMIDRRDDK
FVILRREKLILHHMEKLKTNPRVNEVDPDSLRWTPLLVSNAAVSEEEREAEKEAERLMEQ
ASCWQKEEPEMFSTRANSRLPPAKVQSKNKFVRSPEHLSVIGKRSVDQCKISEDEEDSPQ
SLPPMLMKPQLLGIKRKRPPILRKKRGRKRRRINSSVTTETISETTEVLHEPFESSEKER
QMPQLELSLEMEMERENEDFKPVIKRPFRSRRGRQPRIKEEKEEDNHKCGEGVCDEDVCI
DNLNAVPSLKESTKDNPKPIKRKQGWPKGVKRGPPKWKRKKERKAGFKLNLYTPPETPLE
PDQPGIAEEQKEMLEEIHNEASVVPEEDMDKGEADNQLPDVDLGRLSPEPRSPEEVPTMQ
EENSGIANVELEEAAADNLKEGQGDENVSVNHEGDSPVEKEPPAPPPEHLRDHEEEEEEE
EEPAHNEDHDADDEDDSHMDSTEVEKKNGSTEVLKEVNEGPGAFLDVSEETNNTQYEDTL
DRDSGGDGGDLAADSDDYHENKLAADLEGLPESEDDDHTEDQEQKDSEEPSPEFKEDNVV
SAEIDSETVQAVQSLTQENGEQEGSFQDCTETQEACRSLQSYTHADQSPQVTPLDDCQQS
DHSSPLSSVHSHPSQSVRSVSSPSVPPLENNYTQISPEQGAISVPSLQNMETSPMMDVPS
VSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGGSICGNGSSQNSCSYSSISSSS
LTQSSCAVTQQMASINGSCSMLQQNSLNSPSCSVKSPQGCVVERPPSSNQQQLSQCGMAA
NFTPPMQLTEIPETGNPNIGIYERMGQGDFGAGHFPQPSGTFSLAKLQQLTNTLMDHTLP
YNHSPAVTSYANSVSLSTPLTNTGLVQLSQSTHSVPGGPQAQPTITPPPNLTSSPMNLPP
PLLQRNMAAPNIGLSHAQRLQTQMTSKGHMSMRSKTTTLPPVAAAHQQQIYGRPSQTMAM
QAPARTIAMQRGMNMGVNLMPAPTYNVNSMNMNMNTINAMNSYRMPQPMMNSGYHGNHAY
MNQTAQYQMQMGMMGTQPYAQQPMQTAPHGNMMYSPPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6120 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcgtgctgacccactgtatacagagtggattcttgaagctatacagaaggtt
aaaaggcaaaagcaaaggccgtcggaagaaaggatatgccatgcagtgtcggcatctcat
ggattagataaaaagactgttcaagaacaattggagttaagtgttcaagatggctccatt
cttaaagttacaaataaagggcttgcatcttacaaggatccagataaccctgggcggtta
atgcccattaaagtgggatctttccccaagaccattaagggatctaatagagcctccaat
gacctttgcaatgtggattggaataagctgttgaaaagagccattgaagggctgggagag
cccagcggctcttctttaaagaacatagaaaagtttctgagaagtcaaagtgatttggca
agtattattagcagtccgatgtttcaacggcggttgcggctagcagccaagcgggctgtc
aacaatgggaggttattcaaatatgggcgcctctatctattcaattatggtaacgtggaa
ggaaaaggagtaccaaaatattccagtgcttccacatcatctcttttacccgtcagcctt
cttccccatgaaaaagaccagcctcgggcagatcccattccaatatgcagcttctgtttg
ggcacaaaagagtcaaaccgggaaaaaaagccagaagaacttatttcgtgtgcagattgt
ggtagcagcggtcatccatcatgcttgaagttttctcctgagctaacagctaatgtgaag
gccttacgatggcagtgtatcgagtgtaagacttgtagtgcatgtagggttcaaggcaag
aatgcagataatatgcttttctgtgactcctgtgacagaggatttcacatggagtgctgt
gatcctccactttccagaatgccaaaaggaatgtggatctgccaggtttgccgaccaaag
aaaaaaggaagaaaattgcttcatgaaaaagctgcgcagataaaacgacgatatgcaaag
cccattggaaggcccaaaaataagttaaagcaacgagcattgtctgtagccagcgcagaa
ggatccttgacagcatctgcaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgtgaaggactcaagcagcagattggct
gttacagaccccactcgggctggtgccaccaccaaattcaccaccaccaccttcacctcc
acctccgcctgtacacttaaagttaacaagaaaaccaaagggctcattgacggccttact
aaatttttcaccccatcgcctgatggtcgcaggccgcgtggggaaattgtagacttttct
aagcactatcgtccaaggaaaaagggccctccgaaacagtcatgcacttctcacttcagt
gtgttggctacaggtaccactcaaaagctaaaacccacaccctgtgcacttccaccccct
acccctctgcctgggcagagccccaattcccaaaaatccagcacttcaacctctgctaac
tctccccaaagctcttccagtcagtccagcgtaccttcccttagtagtcttcccagtaac
aaccagctcaagggactttttgatggactttcccacatttttgtcactcagggacagtct
cgaaaaaagggacaccccagttatgcaccgcccagacgcatgcgtcgcaagtctgagacg
tcttccgctatgtccaagtccagtccccatttctgtggcaagaaagagattagaaatagg
ctagtctcccactcctccacatcctctggttgggggatggtcagaggacgggcttttaag
tcaattgcacacttcaggcgagcctctttctttaacaaaaggcacaggctgctaggcagg
ttaaagtataaagtgacccctcagatggggaccccctcaccagggaaggggagcttggca
gacggaaggattaaacctgatcaggatgatgacactgaaggtacaaaaagcttcaaacag
gaaactgcagacccaggtgtgattggcagcaaggagaacgtcacggaagaggacctggag
atatttaagcaagcacaggagctctcgctgcagaaaaccggatgcgtaagagctgttgac
cctcatgggcgctatcctgccatgatagagtttgggaaatatgaaatccaaacctggtac
tcttcgccttatccacaggaatatgcaagactacccaagctcttcctgtgtgaattctgt
cttaaatacatgaagagtagaaacattttgctacggcattcaaaaaaatgtagatggttc
catccccctgccaatgaaatttacagaaagaatgacctctccgtgtttgaggttgatgga
aatataagcaaaatctactgccaaaacctctgcttgttagccaagctttttttggaccat
aaaacgctgtactacgatgttgagccgttcctcttctacgttctcactaaaaatgatgaa
aagggctgtcatctggttggctacttttccaaggagaagctttgccagcagaagtacaat
gtctcctgcataatgattatgccccagtaccaaaggcaaggattcggaaggtttctcatt
gatttcagttatgtactttcaagacgagaagggcaggctgggtcccctgaaaaacccttg
tcagatcttggccgactgtcgtacttggcttattggaaaagtgttgtattgcagtacttg
catcaccacccagagaagcatatcagcatcaagggaatcagcagagcgaccgggatgtgc
ccgcatgacattgccatgaccctacaacagctcaacatgattgatagacgggatgacaag
tttgtaatcctcagaagggaaaaactgatcctccatcacatggagaagctgaaaactaat
ccacgtgtaaatgaggtggatcccgactctctgcgatggaccccactgttggtttctaat
gctgcagtgtctgaagaagagagagaagcagaaaaagaggctgaacgtttgatggaacag
gcaagctgctggcagaaagaggaaccagagatgttttccacaagagccaacagcaggctt
ccacctgccaaagtccagtcgaaaaacaagtttgtaaggtctcctgagcacctgtcagtg
ataggcaaacggtctgtggaccagtgcaagatcagcgaagatgaggaggattcaccacaa
tctctgccacctatgttgatgaagccacaattactaggaataaagagaaagaggcctccc
atcctcaggaaaaagaggggccgtaagcgaaggcggattaacagcagtgttaccacagag
accatttctgaaaccactgaagtcctacatgagccctttgagagctcagaaaaggaacgg
cagatgcctcagttggagctcagcctggagatggagatggagagggagaatgaggatttc
aaacccgtcattaagcgtccgttcaggtctcggcgtggcaggcagccacgcatcaaggag
gagaaggaggaagacaatcataaatgcggagaaggagtctgtgatgaagatgtctgtata
gataacttgaatgcagtaccttcactgaaggaatcaacaaaggacaatcctaaaccaata
aaacgtaaacagggatggccaaaaggagtgaaacgtggtccacctaagtggaaacgcaag
aaggagagaaaagcaggttttaaactgaacctgtacaccccgcctgagactccattggag
ccagaccagccaggcatagcagaagagcaaaaggaaatgttggaagaaatccacaatgaa
gcttctgttgtcccagaggaggacatggacaagggagaggcagacaaccagcttccagat
gtagatctgggaaggttgagccctgaacctcgaagtccagaggaagtacccaccatgcaa
gaggaaaacagtgggatagcaaatgtggagctggaagaagcagcagcagacaatctaaaa
gaaggtcagggagatgagaatgtgagtgtgaaccatgaaggagatagtcctgtggaaaaa
gaaccaccagcaccaccacctgagcacttaagggaccatgaggaggaagaagaggaagag
gaagagcctgctcacaatgaggatcatgatgctgatgatgaagatgatagccacatggat
tccactgaggtggaaaagaagaatggttctacagaggtcttgaaggaagtgaatgaaggc
ccgggggcttttttagatgtaagtgaggaaaccaataacacccagtatgaggacacacta
gatcgtgacagtggtggagatggtggtgatctggcagctgattcagacgattatcatgaa
aacaagctggcggccgatttagaaggtctgccagaatcagaagatgatgaccacacagaa
gaccaagaacaaaaggatagtgaagaaccaagcccagagtttaaagaggataatgttgtt
agtgcagagatagactcagaaacagtgcaggcagttcagtctttgacacaagagaatggt
gagcaggaaggcagtttccaagactgtacagagacacaggaggcatgccgaagcttgcaa
agttacactcatgcagaccagagtccacaggtgactccactggatgactgccagcagtca
gaccatagcagtcctttgtcatctgtccactctcatccaagccaatctgttcgttccgtt
agtagcccgagtgtacctcccctagagaacaactacacacagattagcccagaacagggt
gccatctcggtaccatctttgcaaaacatggaaaccagcccaatgatggacgtcccttca
gtttccgatcactcgcagcaggttgtagacagtgggtttagtgatcttggcagcattgag
agcacaacagaaaactatgaaaaccccagcagttatgactccaccatgggaggaggcagc
atttgcgggaatggctcgtcccaaaatagctgctcgtacagcagcatctcatccagcagt
cttacccagagcagctgcgcagtgacgcagcaaatggcaagcatcaatggaagctgcagt
atgctgcagcaaaacagcctcaattctccaagctgcagcgtgaaatccccgcagggctgt
gttgttgaacgaccaccaagcagtaaccagcagcagctatcacaatgtggcatggctgca
aactttacacctcctatgcagctgacagaaattccagagactggcaaccccaacattggt
atctatgaaaggatgggccaaggtgattttggagctgggcatttcccacagccctcaggt
actttcagcctggccaagctgcagcagttaactaatacgttgatggaccatacattgcct
tacaatcattcaccggctgttacttcctatgcaaacagtgtgtctctgtctacccccttg
acgaacacaggacttgtccagctgtcccagtctacccattctgttcctggaggaccccaa
gcacagcctacaatcacccctccacctaatctaacttcatcacctatgaacttgcctcca
cctctactgcagcgcaacatggctgccccaaacattggcctgtcccacgcccaaagactt
caaacccagatgactagcaagggccacatgtccatgcgatctaaaacgaccaccttacca
ccagtggcagcagctcaccagcaacagatttatggccgtccctcacagacaatggccatg
caggcgcctgctcggacgatagccatgcagcgtggcatgaacatgggggtcaacctgatg
cctgctccaacctacaatgttaattcaatgaacatgaacatgaacaccatcaatgccatg
aacagctataggatgccccagcccatgatgaacagtgggtaccatggcaaccacgcttac
atgaatcagaccgcgcagtaccagatgcaaatggggatgatgggaactcagccatatgcc
caacagcccatgcagacagcaccacatggcaacatgatgtacagcccaccaggccatcat
ggttacatgaacactggcatgtccaagcagtctctaaatggctcctatatgagaaggtag

DBGET integrated database retrieval system