KEGG   Latimeria chalumnae (coelacanth): 102354637Help
Entry
102354637         CDS       T02913                                 

Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B-like
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00512  Mucin type O-glycan biosynthesis
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102354637
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     102354637
Glycosyltransferases [BR:lcm01003]
 Glycan extension
  Type 3 chain
   102354637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 102354637
NCBI-ProteinID: XP_005986229
Ensembl: ENSLACG00000018257
UniProt: H3BFW3
Position
Un
AA seq 386 aa AA seqDB search
MGLLNPRTLNLVFYFGFSVGFLAAYFFMNYVVLEKRQQVKPWNANAATTDAKKVMAVKHN
WKVERSALFSASHPQFSGEDNRIAEDLHDKVRILCWVMTGPSNLETKAVHVKATWSRHCN
IVLFMSSVTDEDFPTVGLDTKEGRDQLYWKTIRAFHYVHEHHLDDADWFMKADDDTFVIV
DNLRWLLSNYTPEQPIYFGRRFKPYVQQGYMSGGAGYVLSKEALKRFVEGFKSKVCSHTT
SVEDLALGHCMQKMGVEAGDSRDTEARETFHPFVPESHLIGKFSKSFWYWNYCFYPIVEG
PQCCSDLAVSFHYVNPQLMYQLEYYTYHLRAYGYRYRYQPALPGKAASLPSHPAKSKVET
RTVGNKMVEKEVKKNETVNVANVKKL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgctgaatcctcggaccttgaacttggttttctatttcggcttctcagtgggt
ttcttggccgcttacttcttcatgaactacgtggtgctggaaaagaggcagcaagtgaag
ccgtggaacgccaacgccgccaccaccgacgccaagaaggtgatggccgtgaagcataac
tggaaagtggagaggtcagcgctctttagcgcctcccatccgcagttctcaggcgaggac
aacagaatagcagaggaccttcacgataaggtgcggatcctctgctgggtgatgacgggc
cccagtaacctggaaacgaaagccgtgcatgtcaaggccacctggtcccgccactgtaac
atcgtgctgttcatgagctctgtgacagacgaggatttccccactgtgggtctggacacc
aaggagggaagggaccagctgtactggaagactatccgagctttccactacgtccacgag
caccacctggacgacgctgactggttcatgaaggcggacgacgacacctttgtcatcgtg
gacaacctcaggtggctgctgtccaactacacccctgagcagcccatttactttggcagg
cggttcaagccgtacgtgcagcaaggctacatgagcggaggggcgggctacgtcttgagc
aaggaggccctcaagcgttttgtggagggcttcaagagcaaagtgtgctcccacaccacg
tcggtggaggacttggccttggggcactgcatgcagaaaatgggggtcgaggccggagac
tcaagagacacagaagcacgggagacgtttcacccttttgtacctgagagccacctgatt
ggaaagttctccaagagcttctggtattggaactattgcttttaccctattgtggagggt
cctcagtgctgctctgacttggccgtctcttttcactacgtcaaccctcagctgatgtat
cagctggaatactatacgtaccacctccgagcgtacgggtaccgctaccgctaccagccg
gctttgccgggcaaggcagcgagcctgccgtcccatcccgccaagagcaaggtggagacc
aggacagttgggaacaaaatggtggagaaggaagtgaaaaaaaatgagactgtaaacgtg
gcaaatgtgaagaagctgtga

DBGET integrated database retrieval system