KEGG   Latimeria chalumnae (coelacanth): 102354637Help
Entry
102354637         CDS       T02913                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:lcm00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 359 aa AA seqDB search
MNYVVLEKRQQVKPWNANAATTDAKKVMAVKHNWKVERSALFSASHPQFSGEDNRIAEDL
HDKVRILCWVMTGPSNLETKAVHVKATWSRHCNIVLFMSSVTDEDFPTVGLDTKEGRDQL
YWKTIRAFHYVHEHHLDDADWFMKADDDTFVIVDNLRWLLSNYTPEQPIYFGRRFKPYVQ
QGYMSGGAGYVLSKEALKRFVEGFKSKVCSHTTSVEDLALGHCMQKMGVEAGDSRDTEAR
ETFHPFVPESHLIGKFSKSFWYWNYCFYPIVEGPQCCSDLAVSFHYVNPQLMYQLEYYTY
HLRAYGYRYRYQPALPGKAASLPSHPAKSKVETRTVGNKMVEKEVKKNETVNVANVKKL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgtggtgctggaaaagaggcagcaagtgaagccgtggaacgccaacgccgcc
accaccgacgccaagaaggtgatggccgtgaagcataactggaaagtggagaggtcagcg
ctctttagcgcctcccatccgcagttctcaggcgaggacaacagaatagcagaggacctt
cacgataaggtgcggatcctctgctgggtgatgacgggccccagtaacctggaaacgaaa
gccgtgcatgtcaaggccacctggtcccgccactgtaacatcgtgctgttcatgagctct
gtgacagacgaggatttccccactgtgggtctggacaccaaggagggaagggaccagctg
tactggaagactatccgagctttccactacgtccacgagcaccacctggacgacgctgac
tggttcatgaaggcggacgacgacacctttgtcatcgtggacaacctcaggtggctgctg
tccaactacacccctgagcagcccatttactttggcaggcggttcaagccgtacgtgcag
caaggctacatgagcggaggggcgggctacgtcttgagcaaggaggccctcaagcgtttt
gtggagggcttcaagagcaaagtgtgctcccacaccacgtcggtggaggacttggccttg
gggcactgcatgcagaaaatgggggtcgaggccggagactcaagagacacagaagcacgg
gagacgtttcacccttttgtacctgagagccacctgattggaaagttctccaagagcttc
tggtattggaactattgcttttaccctattgtggagggtcctcagtgctgctctgacttg
gccgtctcttttcactacgtcaaccctcagctgatgtatcagctggaatactatacgtac
cacctccgagcgtacgggtaccgctaccgctaccagccggctttgccgggcaaggcagcg
agcctgccgtcccatcccgccaagagcaaggtggagaccaggacagttgggaacaaaatg
gtggagaaggaagtgaaaaaaaatgagactgtaaacgtggcaaatgtgaagaagctgtga

DBGET integrated database retrieval system