KEGG   Latimeria chalumnae (coelacanth): 102354766Help
Entry
102354766         CDS       T02913                                 

Definition
(RefSeq) T-cell ecto-ADP-ribosyltransferase 1-like
Organism
lcm  Latimeria chalumnae (coelacanth)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 252 aa AA seqDB search
LGCTEELEFEGFDEAQMEASIVMGMAENSVDDDYKGCSQSVSQLISTVLQNEKNANQKFK
MAWNKARDLWKKKKITLPKGMETDHAIAIIVYSMNEIYSDFNEKTRDYGTKLKQYPYKSL
HFLLTRAIQILTMKPFIEKCKKVYRGTNDKFQTSNRASVRFGQFTSTSINKTVAESFGTR
TVFTITTCFGASIEKYSKFENEQEVLVPPTEVFEVIKFTNGTQTNKILLMSKKRPYSKFR
CQLFKDKPCCWF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ctgggatgtacagaagagcttgagtttgaaggatttgatgaggctcaaatggaagcatcg
atagtgatgggcatggcggagaattctgttgatgatgattataaggggtgtagccaaagt
gtgagtcaactgatatccacagtgcttcagaatgaaaagaatgcaaaccaaaagtttaaa
atggcatggaataaagcaagagatttgtggaaaaagaagaaaattacccttccaaaaggc
atggaaactgaccatgcaattgcaattattgtttattctatgaatgaaatttacagtgac
ttcaatgaaaaaacgagagattatgggacaaagctaaagcaatatccttataaatccctt
cactttcttctaacccgtgcaattcagatcctaaccatgaagcccttcatagaaaagtgc
aaaaaagtatacaggggaaccaacgacaagtttcagacaagtaacagagcatcagtcagg
tttgggcagtttacctccacttccataaacaagacagtagccgaatcgtttggtactaga
acagtgtttacaatcacaacatgctttggagcatcaatagagaaatattcaaagttcgag
aatgagcaggaggtgctggttccacccacagaagtgtttgaagtaataaaattcaccaat
ggaactcaaaccaacaagattctactaatgtcgaagaaaagaccttacagcaaatttcga
tgtcagctttttaaagataagccttgttgctggttttga

DBGET integrated database retrieval system