KEGG   Latimeria chalumnae (coelacanth): 102355330Help
Entry
102355330         CDS       T02913                                 

Gene name
TGM1
Definition
transglutaminase 1
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102355330 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 643 aa AA seqDB search
LGLLPQVSKGTLVIIPVVEELEYNEWGVKIVEATDNVLSLLVNSSPQAVIGRFELTVKLQ
PAGERENRTEHKPANDIYILFNPWCEADAVFVEDEEWRKEYVLNETGRIYYGTKNQIGAR
TWNFGQFDKGVLDACLYLLEKGKMPHSGRGDPISMVRVVSAMVNSQDDRGVLVGNWSGDY
TGGSAPTEWVGSVDILLQFHRTGEPVNYGQCWVFSGVTTTGEFLEMEDRGGGGVFSSKNK
HGGWLGNLVENADSSVTLLSLSGAEFNDFCQLPGRDTKLGRSGPNENFHVWNDCWMARLD
LPPGYGGWQAIDATPQETSAGTYCCGPASLQAIKSGLVYLKCDAPFIFAEVNSDRIYWQR
QHNGTFQKVLVQKNAVGHQISTKAVGLDEREDITHLYKYPEDSEEERIAVETACQYGSKP
TVYLNSAVMEDVALDIQTQEDIQMGSDVTVRVLVENCSSEHRSISLFLKAAVVYYTGVYK
NSFKQDREEVLLSPAEGKELLVVLSYSQYQEYLVDQAAMMLTVSGRVVETGQVLAKQHNF
RLRTPDLQIMPYGEAIVGGQMKAEIVFLNPLPKILKNVTFRIEGPGLQKPKKVQVGDVGR
HATVTLKETFVPTKPGPRKLIASLHCRELTQVHGVAEVIVLSQ
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ttaggattgctgcctcaggtgtccaaggggacccttgtgattatcccggtagtggaggaa
ctagaatacaacgaatggggtgtcaagattgtggaggccaccgacaacgtgctgtctctc
ttggtgaactcctcaccgcaggctgtgattggcaggttcgaactgacagtgaagctgcag
ccagcaggagaaagggagaatcggacagagcacaagcctgctaatgacatctacatcctc
ttcaatccatggtgcgaagctgatgcagtgtttgtggaagatgaggagtggcggaaggaa
tatgtcttgaatgagactggaaggatctattatgggacaaagaaccagattggcgcacga
acatggaactttgggcagtttgataaaggagttctggatgcctgtctgtaccttttggaa
aagggcaagatgccacactctggaaggggagaccccatcagtatggtccgagtcgtctca
gcaatggtgaactcccaggatgatcgtggtgttctggtcgggaactggtcaggtgattac
actggaggctcagccccgaccgaatgggtgggcagtgtggatatccttctccaattccat
cggactggcgaaccagtcaattacggacagtgctgggtcttctctggggtcactaccacg
ggtgagtttcttgaaatggaggatcgggggggggggggagtcttctcttcaaaaaacaaa
catggtggctggcttggtaacctagtagaaaatgctgactctagtgtgacattgcttagt
ctgagtggggctgagtttaatgatttctgccagttacctggaagggatactaaattgggc
agaagtggccccaatgagaatttccatgtgtggaatgactgctggatggcacggctggat
ctcccaccagggtatgggggatggcaggcaattgatgctacacctcaggaaaccagcgct
ggtacgtactgctgcggtcctgcttctctccaagccatcaagagcgggctggtctatcta
aagtgtgacgctccgttcatctttgcagaggtgaacagtgacagaatttactggcagagg
caacacaatggaaccttccagaaagtccttgtgcagaaaaatgccgtcgggcaccagatc
agcacgaaggcagtgggtttggacgagagagaagacatcacccacctctacaaatacccg
gaagattcggaagaagagcggatcgctgtggagacggcctgtcagtacggcagcaagccc
actgtttatttgaactctgctgtgatggaggatgtggcgcttgacatccaaacgcaggag
gacatccagatgggtagtgacgtgactgtgcgggtgctggtggagaactgcagctcggaa
caccggagcatctcgctgtttctgaaggcggctgtcgtttattacaccggcgtctacaag
aacagctttaagcaagaccgagaggaggtcctgctgtcccctgccgaaggtaaagagttg
ctggtggtattaagttatagccagtaccaggaatatctggtggatcaggctgccatgatg
ttaactgtgtccggaagggtcgtcgagacgggacaggtccttgccaagcagcacaacttc
cgcctgcgcacccctgacctccagatcatgccgtatggagaggctattgtgggaggacaa
atgaaagccgagatcgtcttcctgaatccactgccgaagattctgaaaaacgtcactttc
cggattgagggtccagggctccagaaacccaagaaggtccaagttggtgatgttggacgc
catgccactgttaccctcaaggaaacctttgtccccaccaagcctggcccccggaaactc
attgccagtctccactgccgtgagctgacccaagttcatggggttgcagaggtcatcgtg
ctgagccagtga

DBGET integrated database retrieval system