KEGG   Latimeria chalumnae (coelacanth): 102356244Help
Entry
102356244         CDS       T02913                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:lcm00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 786 aa AA seqDB search
MAEERLNAGAQADLPDNSLRKRGKEVRAKGVGDLQEEGGKPRGCSQVQAGELKHKDQGGK
NLGGQSEEMYANGTSLGTRFLRPSLTTALNEGVSHPLHLLILVTLLSFATRFYKISEPPH
VCWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLTGYNGTFPFQKPGDRYEEHHY
IGMRMFCALLGSCLVPFAYLTVLELSKSLPAALLATATLIFDTGCITISQYILLDPILLF
FIMGSVLSMVKFNSQQHRPFCTCWWFWLTLTGTNLAGALGVKFVGLFVILLVGLNTVHDL
WRLLGDISLSMVSFGKHLLARVLCLILLPVSLYMTLFAIHFFVLNKSGPGDGFFSSAFQS
RLIGNNLHNASMPEYLAYGSVITLKNIRIAGGYLHSHWHLYPEGVGARQQQVTAYLHKDY
NNLWIVKKPKANPAGPSDPVKYIKHGDLVRMEHKETSRNLHSHPHEAPLTKKHFQVTGYG
LNGTGDPNDYWRIEVIGGKTGDLVKVLRSKIRLVHLATGCYLYSSGKTLPKWGWEQAEVT
CSPYMKETPNSLWNVEDHFNTKLPNISLEVLKPSFPEILIESHIVMIRGNSGLKPKENEV
TSKPWHWPINYQGLRFSGVNETEYRVYLLGNPIIWWLNLVSIGLYITMTSIAAIAIQRGS
QLTSNVKEISQVLLYGAGQIMLGWVLHYFPFYFMGRILYYHHYFPAMLFSSMLTGVTWDT
LLKSCDLLLPQPIARRVYINGVALLIILILYSFYLFHPLSYGMIGPLAHEPSSPMAGLRW
MESWEF
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggaacgacttaatgcaggagcccaggcggacctcccagataacagtttgcgt
aagagaggaaaagaagtccgagcaaaaggggtgggtgatctccaggaagagggaggaaag
cccagagggtgttcccaagtccaagctggagagctgaaacataaggatcaaggaggaaag
aacctgggaggtcaaagtgaggagatgtatgccaatgggaccagcctagggaccagattt
ctgaggccgagcttgaccactgccctaaatgaaggtgtatctcatccgctgcatcttcta
attctggtgactctgctttcctttgcaacccggttttataagatctcagagccacctcat
gtctgttgggatgaaactcattttggtaaaatgggtagctattacattaacaggaccttc
ttctttgatgttcacccgccactaggaaagatgctgatcgggttggctggatacctgact
ggatataatggtactttccccttccagaaaccaggagaccgatatgaggaacatcattat
ataggaatgagaatgttctgtgctctgcttgggtcctgcctggtgccttttgcctacctc
actgtgttggagctgtccaaatcattgcctgcagcgctgctcgccactgccacactcatt
ttcgatacaggttgcatcactatctcacagtacatcctgctggatcccattctgttattt
tttataatgggatcagtgctgagcatggtgaaatttaactcccagcaacacaggcccttt
tgtacttgctggtggttttggctgactttaacggggacaaatcttgctggcgctttgggg
gtgaagtttgtggggctgtttgtcatccttctggttggactcaacacagtccacgacctc
tggaggctgctgggggacatcagtttgtcaatggtttcctttggaaagcacttgctggcc
cgagttctgtgccttattctgctgccagtgtccctctacatgaccctctttgccattcac
ttctttgtcttaaacaaaagtggcccaggagatggtttcttcagctcagctttccagtct
cgcctaattgggaacaacctacacaacgccagcatgccagaatacctggcatatggctca
gttatcactttgaagaacatccggatagctggcggttacctacactcacactggcacctt
tacccagagggggtcggagcgcgacagcaacaggtcactgcttacttgcacaaagactac
aataacctgtggattgtaaagaaacccaaagcgaaccctgcaggtccttccgacccagtg
aagtacatcaagcatggtgaccttgtcaggatggagcacaaagaaacttctagaaatctc
catagtcacccacacgaagcaccgttgacaaagaaacacttccaggtcacgggatatgga
ctaaatggaacaggagacccgaacgattactggaggattgaggtcattggcgggaagacc
ggagacctagtcaaggttctgcgaagcaagatccgattggtccatctggcaactggctgt
tacctctactcttctgggaagacactgccaaaatggggctgggaacaggcagaagtcaca
tgcagtccgtacatgaaagaaactcccaactctctttggaacgtggaagatcactttaac
accaagttgccaaacatcagtcttgaggttctgaagccgtcgtttcctgagattctgatt
gagtcgcacatcgtaatgatcaggggaaatagtggattgaaacccaaagaaaatgaagta
acttcaaaaccctggcactggccaattaactaccagggtctgcgtttctctggcgttaat
gagactgaatatcgagtttatttgctgggcaatcctattatttggtggttaaacttggtc
agtatcggtctgtacatcaccatgaccagcattgcagccatcgccattcagagagggagt
cagctgacctcaaatgttaaagaaatatctcaggtcctgctatatggggcgggccagata
atgctgggctgggtgctccattacttccctttttacttcatgggtcgaattctctactac
caccactactttccagccatgctcttttccagcatgttaacaggagttacttgggatacc
cttctaaagagctgtgacctgctcctaccacagccgattgcaagaagagtgtacatcaat
ggagtagccttgctgatcattcttattctgtacagcttctacctctttcacccactgtcc
tatggaatgattgggcccctcgctcacgaacccagcagccccatggcgggacttaggtgg
atggaatcatgggaattttag

DBGET integrated database retrieval system