KEGG   Latimeria chalumnae (coelacanth): 102356713Help
Entry
102356713         CDS       T02913                                 

Gene name
CHKA
Definition
(RefSeq) choline kinase alpha
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00564  Glycerophospholipid metabolism
lcm01100  Metabolic pathways
Module
lcm_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
lcm_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102356713 (CHKA)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     102356713 (CHKA)
    2.7.1.82  ethanolamine kinase
     102356713 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 102356713
NCBI-ProteinID: XP_005988063
Ensembl: ENSLACG00000018530
Position
Un
AA seq 412 aa AA seqDB search
MKNKFSDATIEATMAELLIASNGLQLRAEVEEEYKEGREEEVDPETKGKAFLWCKAFLHG
AWKSLHPDEFQISVIRGGLSNRLFLCSLPDTKKSVGDEPRNVLLRLYGAILQMSKSESTK
PKTEDEFRGADSMMLESVMFAILAERTLGPKLYGIFPQGRLEQFVPSRMLASKEQCLPDI
SAEIAQKMAKFHKMEMPCNKEPTWLFGTMEKYLNQVLALNFIKESQIRKLNKLLNYNLPQ
ELDILRSLLEVTSSPVVFCHNDCQGGNLLLLEGRENCAKDKLMLIDFEYSSYNYRGFDIG
NHFCEWMYDYSHQKFPFFLESAKKYPTKKQQIYFISNYLAEYHNGYENFSSEEKVKIVQG
MLVEVNRFALASHFFWGLWSIIQAKISSIEFGYMDYALARFDSYFKQKKIVA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaattcagcgacgcgacgatcgaggccaccatggcggagctgctgatcgcc
tccaatgggctgcagctgcgagccgaagtggaagaagagtacaaggaaggacgggaggaa
gaggtggaccccgagaccaagggcaaagctttcctctggtgtaaagcctttctgcacgga
gcctggaaaagcctccacccggacgagtttcaaatctctgtcataagaggtggcctcagt
aaccggcttttcttgtgctccttaccagacactaaaaaaagtgttggggatgaaccccgt
aatgttcttcttcgtttgtatggtgcgatcttgcagatgtccaaaagtgaatccacaaaa
ccaaagacagaggatgagtttcgaggtgctgattctatgatgctggagagtgttatgttt
gctattctggcagagagaaccctgggaccaaaactttatggaatcttcccacaaggcaga
cttgaacagttcgttccgagtcggatgctggcctccaaagaacagtgtctgcctgatata
agtgcagaaatagcacagaaaatggccaagttccacaaaatggaaatgccttgtaataag
gaacctacatggctgtttgggacaatggaaaagtacttaaatcaagtattggcgttaaac
tttataaaggaatctcagatccgcaaactgaacaaactcctgaattacaatctgccgcaa
gagttggacatcttaagatctttgctagaagttacttcatcaccagtagtgttctgtcac
aatgactgccaaggtggcaaccttttgcttctggaaggcagggagaactgtgccaaagat
aaactcatgttgattgactttgaatatagcagttataactacaggggatttgacattgga
aaccatttttgtgaatggatgtatgattattctcaccaaaaatttccattctttttggaa
agtgctaagaagtaccccacaaagaagcagcagatttacttcatttccaattatctagct
gaataccataatggatatgaaaatttcagcagtgaagaaaaggtcaaaatagtgcaagga
atgttggtagaagtgaacaggtttgctcttgcatcacatttcttttggggcttatggtcc
attatacaagccaagatttcttcaattgagtttggctacatggattatgctttggcaaga
tttgattcctattttaaacagaagaaaattgtggcatga

DBGET integrated database retrieval system