KEGG   Latimeria chalumnae (coelacanth): 102356812Help
Entry
102356812         CDS       T02913                                 

Gene name
CKMT1B
Definition
creatine kinase, mitochondrial 1B
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102356812 (CKMT1B)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102356812 (CKMT1B)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102356812 (CKMT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 418 aa AA seqDB search
MASTFTRLFSSKKTTSLLAMVGAGSVATTYFLTRDKVQASVEGRRRLYPPSAEYPDLRKH
NNCMADNLTPAMYARLSGKVTPNGYTLDECIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
ELFDPVIMERHNGYDPRTMKHTTDLDASKIKSGYFDERYVLSSRVRTGRSIRGLSMPPAC
TRAERREVERVVSDALNGLKGELAGRYYRLTDMTEQEQQQLIDDHFLFDKPVSPLLTASG
MARDWPDARGIWHNNEKTFLVWVNEEDHTRVISMEKGGNMKRVFERFCKGLKEVEMLIQE
KGWEFMWNERLGYILTCPSNLGTGLRAGVHINLPRLAKDPRFSKILENLRLQKRGTGGVD
TAAVGSTFDISNLDRLGKSEVELAQLVIDGVNYLVDCEKRLERGQDIKIPAPVQQFKR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccttcaccagacttttctccagcaagaagaccactagcctcttggccatg
gtgggagccggatctgtagctactacctactttctcaccagggataaagtgcaagcttct
gttgagggcaggagaagactttaccctccaagcgcagagtatccggacctgaggaaacac
aataactgcatggcagacaatctaacgccagccatgtatgcccggctgagcggcaaggtc
accccgaacggctacacactggatgagtgcatccagactggtgtggacaaccctggacac
cccttcatcaagacagttggcatggtggcaggagacgaggagtcttatgaggtatttgct
gaactgtttgatccggtcattatggagagacacaatggctacgaccctcggaccatgaaa
cacaccactgacctggacgcaagcaaaataaaatctgggtattttgatgaacgctacgtc
ctgtcgtcccgcgtgcgtacagggaggagcatccgtggcctgagcatgccccctgcttgc
acccgtgccgagaggagggaggtggagcgggtagtgtcggatgccctgaatgggctgaaa
ggagaattggccgggcgatactaccgtctgacggacatgactgaacaggaacagcagcag
ctgattgatgatcacttcctgtttgataagccagtttccccactgctgacggcctcagga
atggctcgtgattggccagacgcccgtggaatctggcacaacaatgagaagaccttcctg
gtctgggtgaacgaggaggatcacacccgtgtcatctccatggaaaagggaggcaacatg
aagagggtttttgagcggttctgcaaaggccttaaggaggtagagatgctgatccaggag
aaaggctgggaattcatgtggaacgagcgtttgggatacatcctaacctgtccgtcaaac
ctggggactggactgagagctggagtgcatatcaatctcccacgactagccaaggatcct
cgtttctcaaagattttggagaatctgcgtctgcagaaacgtgggactggtggggtggac
acagccgctgttggaagcacctttgatatctccaatctggatcgtcttggaaagtctgag
gtggaattggcacagttggtgattgatggagttaactatttagtggactgtgagaagagg
ctggaaagagggcaggacatcaagatccccgcccccgtacagcagtttaaacgttaa

DBGET integrated database retrieval system