KEGG   Latimeria chalumnae (coelacanth): 102357374Help
Entry
102357374         CDS       T02913                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00250  Alanine, aspartate and glutamate metabolism
lcm00410  beta-Alanine metabolism
lcm00430  Taurine and hypotaurine metabolism
lcm00650  Butanoate metabolism
lcm01100  Metabolic pathways
Module
lcm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102357374 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102357374 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102357374 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102357374 (GAD1)
Enzymes [BR:lcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102357374 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 102357374
NCBI-ProteinID: XP_006003035
Ensembl: ENSLACG00000012739
UniProt: H3AXV6
Position
Un
AA seq 590 aa AA seqDB search
MATSAPSSSGDSPDPNTTSLRPTTYDTWCGVAHGCTKKLGLKICGFLQRNNSLDDKSRIV
SSLKERQSATNVLPCENSERHTRFRRAETDFSNLFARDLLPAKNGEEQTMQFLLEVVDIL
LNYIKKTFDRSTKVLDFHHPHQLLEGMEGFNIELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWPNGDG
DGIFSPGGAISNMYSVMAARYKYFPDVKSKGMAAVPKLVLFTSEHSHYSIKKAGAALGIG
TDNVILIKCNERGKIIPADLEAKILEAKQKGHVPIYVSATAGSTVFGAFDPVQEIADICE
KYNLWLHVDAAWGGGILMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGIL
QGCNQMCAGYLFQQDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELSEYLYTKIKRRDGFEMVFDGEPEHTNVCFWYVPPSLRGMPDCEERREKLHKVAPKIKA
QMMESGTTMVGYQPQGDKVNFFRMVVSNPASTRSDIDFLIEEIERLGQDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccacctctgctccttcttcctctggcgacagtcccgatcctaataccaccagtttg
cgacccaccacatatgacacttggtgtggggttgctcatggatgtaccaaaaaactagga
ctcaagatctgtgggttcttgcagaggaacaatagcctggatgacaagagccggattgtg
agttccttgaaggagcggcagtctgccaccaacgtgctgccttgtgagaacagcgagcgg
cacacccgattccggcgcgccgagactgatttctccaatctcttcgccagagatttgcta
cctgccaagaatggagaggagcagaccatgcagttcctgttggaggttgttgacatacta
ctcaactacattaagaagacctttgacaggtctaccaaagtactggattttcaccacccc
catcaacttctggaaggaatggagggcttcaacatagaactttcggacaatcctgagtct
ctggagcagattcttgtggactgtagagacactcttaaatatggagtcagaacaggccac
cctcgtttttttaaccagctttccagtggactggatattattggactggctggagaatgg
ctgacatcaactgccaataccaatatgttcacatatgaaatagctccagtttttgtttta
atggaacaaatcacactgaagaaaatgagggagattataggatggcccaatggagatgga
gatggaatattttcaccgggaggtgctatttctaacatgtacagcgtaatggctgcacgc
tacaagtattttcccgatgtgaaatccaagggcatggcagctgttcctaaactggtcctt
ttcacttcagaacatagtcattattcaataaagaaagcaggcgctgcacttgggattggc
acagacaatgtgattttgataaaatgtaatgaaaggggaaaaataataccagctgatttg
gaagcaaaaattcttgaagctaagcaaaaggggcatgtgccaatttatgtaagtgcaaca
gcaggttctacagtatttggagcatttgatcctgtccaagaaattgcagacatttgtgaa
aagtacaacctttggctccatgtagatgctgcttggggaggtggaatactcatgtccaga
aagcatcgtcataagctgaatggtatagaaagagctaattcagtcacatggaatcctcat
aagatgatgggagttttgctgcagtgttctgcaatccttgtcagagaaaagggtatactt
cagggttgcaatcagatgtgtgcggggtacttattccagcaagataagcagtatgatgta
tcctatgacacaggtgataaagctatacagtgtggtcgtcatgtggacatcttcaagttc
tggttgatgtggaaagcaaagggtacagtaggatttgaaaatcagattaataagtgtttg
gaactgtcagaatacctgtatactaaaattaaaaggagggacggatttgaaatggtcttc
gatggagagcctgagcacacaaatgtttgtttctggtacgttccacctagtctcaggggt
atgccagattgtgaagagagaagagaaaagctacataaggttgctccaaaaatcaaagca
cagatgatggaatcaggtactactatggttggatatcagcctcagggagataaagtcaac
ttcttccgaatggttgtctcaaatccggcctccacaaggtctgacattgacttccttatt
gaagaaatagagagacttgggcaggatttgtaa

DBGET integrated database retrieval system