KEGG   Latimeria chalumnae (coelacanth): 102358757Help
Entry
102358757         CDS       T02913                                 

Gene name
JOSD1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102358757 (JOSD1)
Peptidases [BR:lcm01002]
 Cysteine Peptidases
  Family C86
   102358757 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 199 aa AA seqDB search
MSCVPWKGEKLKFESELQCPPQIYHEKQRRELCALHALNNVFQDGSAFTRETLQDICQSL
SSTSMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRKDVKLIALSNVKGFIMNVP
SSLCWGPVKLPLKRPHWIGVRQVGGAYYNLDSKLKGPEQIGNEEDLRAFLKQHLNGKHCE
ILLVVPEEVEVQHTWRTDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgttccgtggaagggggagaagttgaaatttgagtccgagttgcagtgccct
cctcagatctaccatgagaagcagcggcgggagttgtgtgcactccacgctctgaataac
gttttccaggatggaagcgccttcacaagggagaccctacaggacatctgtcagagctta
tcttccacgtctatggttacaccacacaagaaaagcatgttgggtaatggcaattatgat
gtcaatgtgatcatggcagcactacagacaaaaggatacgaagctgtttggtgggacaag
agaaaggatgtgaagctgattgcactttccaacgtgaagggttttataatgaacgtgccc
tccagcctctgttggggtcccgtcaagctgcctctcaagaggccacactggatcggagtc
cgccaggtgggcggggcttactacaatctggactccaagctcaaagggcccgagcagatc
gggaatgaagaggacctcagggccttcctgaaacagcatctgaatgggaaacactgtgag
attctattggttgtccccgaggaagtagaagtccagcacacctggcggacagacgtttga

DBGET integrated database retrieval system